CPT1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CPT1_YEAST
• UniProt AC: P17898
• Protein Name: Cholinephosphotransferase 1
• Gene Name: CPT1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 393
• Subcellular Localization: Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein.
• Protein Description: Catalyzes the final step in the CDP-choline route leading to phosphatidylcholin (PC). Preferentially uses CDP-monomethylethanolamine as aminoalcohol substrate. Shows highest activity toward di- and mono-unsaturated diacylglycerol species as lipid substrates. The CDP-choline pathway only contributes to net PC synthesis if exogenous choline is present. In its absence, this pathway recycles choline from PC turnover and may contribute to maintaining the proper PC species composition..
• Protein Sequence: MGFFIPQSSLGNLKLYKYQSDDRSFLSNHVLRPFWRKFATIFPLWMAPNLVTLLGFCFIIFNVLTTLYYDPYFDQESPRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCIDSINTTLSMIPVCSMTGMGYTYMTIFSQFAILCSFYLSTWEEYHTHKLYLAEFCGPVEGIIVLCISFIAVGIYGPQTIWHTKVAQFSWQDFVFDVETVHLMYAFCTGALIFNIVTAHTNVVRYYESQSTKSATPSKTAENISKAVNGLLPFFAYFSSIFTLVLIQPSFISLALILSIGFSVAFVVGRMIIAHLTMQPFPMVNFPFLIPTIQLVLYAFMVYVLDYQKGSIVSALVWMGLGLTLAIHGMFINDIIYDITTFLDIYALSIKHPKEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MGFFIPQSSLGNLKL CCCCCCHHHCCCEEE	23.36	19823750
9	Phosphorylation	GFFIPQSSLGNLKLY CCCCCHHHCCCEEEE	34.74	19795423
16	Phosphorylation	SLGNLKLYKYQSDDR HCCCEEEEEECCCCC	13.18	28132839
17	Ubiquitination	LGNLKLYKYQSDDRS CCCEEEEEECCCCCC	47.45	23749301
17	Acetylation	LGNLKLYKYQSDDRS CCCEEEEEECCCCCC	47.45	22865919
250	Ubiquitination	YYESQSTKSATPSKT HHCCCCCCCCCCCHH	43.25	23749301
256	Ubiquitination	TKSATPSKTAENISK CCCCCCCHHHHHHHH	53.62	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CPT1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CPT1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CPT1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEC22_YEAST	SEC22	genetic	16269340
ILM1_YEAST	ILM1	genetic	16269340
RBD2_YEAST	RBD2	physical	18467557
CPT1_YEAST	CPT1	physical	18467557
ERP2_YEAST	ERP2	physical	16093310
PHO88_YEAST	PHO88	physical	16093310
MKAR_YEAST	IFA38	physical	16093310
GMT2_YEAST	HVG1	physical	16093310
EMP24_YEAST	EMP24	physical	16093310
COS6_YEAST	COS6	physical	16093310
COS8_YEAST	COS8	physical	16093310
ERP5_YEAST	ERP5	physical	16093310
EPT1_YEAST	EPT1	physical	16093310
VDAC2_YEAST	POR2	physical	16093310
ESBP6_YEAST	ESBP6	physical	16093310
COS1_YEAST	COS1	physical	16093310
ERP4_YEAST	ERP4	physical	16093310
ALG8_YEAST	ALG8	physical	16093310
BRE1_YEAST	BRE1	genetic	21987634
CYK2_YEAST	HOF1	genetic	21987634
PHO23_YEAST	PHO23	genetic	21987634
RT106_YEAST	RTT106	genetic	21987634
BNI4_YEAST	BNI4	genetic	21987634
RTG1_YEAST	RTG1	genetic	21987634
PLMT_YEAST	OPI3	genetic	23891562
ASK10_YEAST	ASK10	genetic	27708008
FMT_YEAST	FMT1	genetic	27708008
MNN2_YEAST	MNN2	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
LTHAD_YEAST	SRY1	genetic	27708008
VPS51_YEAST	VPS51	genetic	27708008
RAD14_YEAST	RAD14	genetic	27708008
RS10A_YEAST	RPS10A	genetic	27708008
YME1_YEAST	YME1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.