UniProt ID | COS8_YEAST | |
---|---|---|
UniProt AC | P38723 | |
Protein Name | Protein COS8 | |
Gene Name | COS8 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 381 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | ||
Protein Sequence | MKENEVKDEKSVDVLSFKQLEFQKTVLPQDVFRNELTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSSNWIHPLIVSLLVLFLGPFFVLVICGLSRKRSLSKQLIQFCKEITEDTPSSDPHDWEVVAANLNSYFYENKTWNTKYFFFNAMSCQKAFKTTLLEPFSLKKDESAKVKSFKDSVPYIEEALQVYAAGFDKEWKLFNTEKEESPFDLEDIQLPKEAYRFKLTWILKRIFNLRCLPLFLYYFLIVYTSGNADLISRFLFPVVMFFIMTRDFQNMRMIVLSVKMEHKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWNNEEFFYDGLDCEWFFRRFFYRLLSLKKPMWFASLNVELWPYIKEAQSARNEKPLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Ubiquitination | ENEVKDEKSVDVLSF CCCCCCCCCCCEEEH | 66.95 | 24961812 | |
11 | Phosphorylation | NEVKDEKSVDVLSFK CCCCCCCCCCEEEHH | 22.85 | 21440633 | |
16 | Phosphorylation | EKSVDVLSFKQLEFQ CCCCCEEEHHHHEEC | 30.19 | 22369663 | |
111 | Phosphorylation | IQFCKEITEDTPSSD HHHHHHHHCCCCCCC | 28.97 | 25704821 | |
170 | Phosphorylation | FSLKKDESAKVKSFK CCCCCCCCCCCCCHH | 43.45 | 27017623 | |
205 | Ubiquitination | WKLFNTEKEESPFDL EECCCCCCCCCCCCH | 65.82 | 23749301 | |
208 | Phosphorylation | FNTEKEESPFDLEDI CCCCCCCCCCCHHHC | 31.77 | 27214570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COS8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COS8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COS8_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...