YAJ3_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAJ3_YEAST
• UniProt AC: D6VPM8
• Protein Name: Putative DUP240 protein YAR023C
• Gene Name: YAR023C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 179
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MINFLLFVLTILATLTNIWFSGVLSPAMVIRICLGGSMVVLQIWSFSRPISNETFRTKLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIKGKYPDVQWDTANTQPFISVPENQAATQNSDVEPTVKWCLFKAAEIQAHAVREYWQSQYPDVGIPAI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YAJ3_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YAJ3_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAJ3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAJ3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TIM22_YEAST	TIM22	physical	16093310
NCBP2_YEAST	CBC2	genetic	27708008
YGZ2_YEAST	YGL242C	genetic	27708008
SCS7_YEAST	SCS7	genetic	27708008
KTR1_YEAST	KTR1	genetic	27708008
FABD_YEAST	MCT1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.