dbPTM

MST28_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MST28_YEAST
UniProt AC	P39552
Protein Name	Multicopy suppressor of SEC21 protein 28
Gene Name	MST28
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	234
Subcellular Localization	Endoplasmic reticulum . Golgi apparatus . Cytoplasmic vesicle, COPI-coated vesicle membrane Multi-pass membrane protein . Cytoplasmic vesicle, COPII-coated vesicle membrane Multi-pass membrane protein .
Protein Description	Involved in protein trafficking vesicle formation, probably by stabilizing of coatomer at the Golgi membrane and thus allowing the efficient formation of COPI coated vesicles..
Protein Sequence	MQTPPESTDVKLDTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGVLVLLIIFFNDNEACVFNSAIFAFTSLVGLLIILSDGNPKLVSRRNFRTELLVDVITRKPAVEGKEWRIITYNMNQYLFNHGQWHTPYYFYSDEDCYRYFLRLVEGVTPKKQTATSIGNSPVTAKPEDAIESASPSSRLNYQNFLLKAAEIERQAQENYWRRRHPNIDALLKKTE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MQTPPESTDV -----CCCCCCCCCC	39.24	27214570
167	Phosphorylation	LRLVEGVTPKKQTAT HHHHCCCCCCCCCCC	40.00	27214570
172	Phosphorylation	GVTPKKQTATSIGNS CCCCCCCCCCCCCCC	40.56	28889911
174	Phosphorylation	TPKKQTATSIGNSPV CCCCCCCCCCCCCCC	25.02	29688323
175	Phosphorylation	PKKQTATSIGNSPVT CCCCCCCCCCCCCCC	26.49	27017623
179	Phosphorylation	TATSIGNSPVTAKPE CCCCCCCCCCCCCHH	18.61	21440633
182	Phosphorylation	SIGNSPVTAKPEDAI CCCCCCCCCCHHHHH	32.14	23749301
191	Phosphorylation	KPEDAIESASPSSRL CHHHHHHHCCCCHHH	28.12	29688323
193	Phosphorylation	EDAIESASPSSRLNY HHHHHHCCCCHHHHH	34.30	23749301
195	Phosphorylation	AIESASPSSRLNYQN HHHHCCCCHHHHHHH	26.12	23749301
196	Phosphorylation	IESASPSSRLNYQNF HHHCCCCHHHHHHHH	44.14	29688323

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MST28_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MST28_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MST28_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SEC24_YEAST	SEC24	physical	12925749
MST27_YEAST	MST27	physical	12925749
MST28_YEAST	MST28	physical	11283351
MST28_YEAST	MST28	physical	18719252
BCK1_YEAST	BCK1	genetic	23891562
COPB_YEAST	SEC26	genetic	23891562
GPR1_YEAST	GPR1	genetic	27708008
NDH2_YEAST	NDE2	genetic	27708008
INO4_YEAST	INO4	genetic	27708008
KPC1_YEAST	PKC1	genetic	27708008
EIF3A_YEAST	RPG1	genetic	27708008
CALM_YEAST	CMD1	genetic	27708008
RPB1_YEAST	RPO21	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
TFB1_YEAST	TFB1	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
SAD1_YEAST	SAD1	genetic	27708008
CDC20_YEAST	CDC20	genetic	27708008
MPPA_YEAST	MAS2	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
MCM10_YEAST	MCM10	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
PRS7_YEAST	RPT1	genetic	27708008
BET5_YEAST	BET5	genetic	27708008
DCP2_YEAST	DCP2	genetic	27708008
SEC12_YEAST	SEC12	genetic	27708008
MOT1_YEAST	MOT1	genetic	27708008
SGF29_YEAST	SGF29	genetic	27708008
ELO2_YEAST	ELO2	genetic	27708008
GCS1_YEAST	GCS1	genetic	27708008
SWI4_YEAST	SWI4	genetic	27708008
LCL3_YEAST	LCL3	genetic	27708008
MED5_YEAST	NUT1	genetic	27708008
VMA21_YEAST	VMA21	genetic	27708008
RS27B_YEAST	RPS27B	genetic	27708008
RS21B_YEAST	RPS21B	genetic	27708008
YJQ3_YEAST	YJL163C	genetic	27708008
ECM22_YEAST	ECM22	genetic	27708008
SOK2_YEAST	SOK2	genetic	27708008
RCO1_YEAST	RCO1	genetic	27708008
NST1_YEAST	NST1	genetic	27708008
SUR1_YEAST	SUR1	genetic	27708008
YP260_YEAST	YPL260W	genetic	27708008
MDM36_YEAST	MDM36	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MST28_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-3, AND MASSSPECTROMETRY.	18407956 [Abstract]