| UniProt ID | BET5_YEAST | |
|---|---|---|
| UniProt AC | Q03630 | |
| Protein Name | Trafficking protein particle complex subunit BET5 | |
| Gene Name | BET5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 159 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. Preautophagosomal structure. | |
| Protein Description | Component of the TRAPP I, TRAPP II and TRAPP III complexes which act as guanine nucleotide exchange factors (GEF) for YPT1. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. TRAPP II plays a role in intra-Golgi transport. TRAPP III plays a role in autophagosome formation. Required for sporulation. Has a role late in meiosis following DNA replication.. | |
| Protein Sequence | MGIYSFWIFDRHCNCIFDREWTLASNSASGTINSKQNEEDAKLLYGMIFSLRSITQKLSKGSVKNDIRSISTGKYRVHTYCTASGLWFVLLSDFKQQSYTQVLQYIYSHIYVKYVSNNLLSPYDFAENENEMRGQGTRKITNRNFISVLESFLAPMVNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Phosphorylation | RSISTGKYRVHTYCT EECCCCCEEEEEEEC | 21.15 | 28889911 | |
| 79 | Phosphorylation | TGKYRVHTYCTASGL CCCEEEEEEECHHCC | 19.89 | 28889911 | |
| 80 | Phosphorylation | GKYRVHTYCTASGLW CCEEEEEEECHHCCE | 3.49 | 28889911 | |
| 82 | Phosphorylation | YRVHTYCTASGLWFV EEEEEEECHHCCEEE | 17.28 | 28889911 | |
| 98 | Phosphorylation | LSDFKQQSYTQVLQY EHHHCCCCHHHHHHH | 27.88 | 27017623 | |
| 100 | Phosphorylation | DFKQQSYTQVLQYIY HHCCCCHHHHHHHHH | 19.90 | 27017623 | |
| 105 | Phosphorylation | SYTQVLQYIYSHIYV CHHHHHHHHHHHHHH | 9.54 | 27017623 | |
| 107 | Phosphorylation | TQVLQYIYSHIYVKY HHHHHHHHHHHHHHH | 6.83 | 27017623 | |
| 108 | Phosphorylation | QVLQYIYSHIYVKYV HHHHHHHHHHHHHHH | 8.21 | 27017623 | |
| 111 | Phosphorylation | QYIYSHIYVKYVSNN HHHHHHHHHHHHHCC | 5.86 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BET5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BET5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BET5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
