dbPTM

VPS55_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VPS55_YEAST
UniProt AC	P47111
Protein Name	Vacuolar protein sorting-associated protein 55
Gene Name	VPS55
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	140
Subcellular Localization	Endosome membrane Multi-pass membrane protein .
Protein Description	Involved in protein transport from endosomes to the vacuole..
Protein Sequence	MMEFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILIFLLAPIPNTIFNAGNKYHTSDFMSDSSNTGQDLAHFLTGMLVTSGIALPVVFYHCQLIGHLSCIMCMIGGLIIYSSIVIFKWFFKKDFNEDDSLFG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
137	Phosphorylation	KDFNEDDSLFG---- CCCCCCCCCCC----	37.61	22890988

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VPS55_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VPS55_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VPS55_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UIP3_YEAST	UIP3	physical	18719252
VPS68_YEAST	VPS68	physical	18719252
HAL5_YEAST	HAL5	genetic	20206679
RV161_YEAST	RVS161	genetic	27708008
AAKG_YEAST	SNF4	genetic	27708008
GOSR1_YEAST	GOS1	genetic	27708008
VPS8_YEAST	VPS8	genetic	27708008
REG2_YEAST	REG2	genetic	27708008
YBQ3_YEAST	YBR053C	genetic	27708008
RDH54_YEAST	RDH54	genetic	27708008
PEX32_YEAST	PEX32	genetic	27708008
YBP1_YEAST	YBP1	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
RS16A_YEAST	RPS16B	genetic	27708008
RS16B_YEAST	RPS16B	genetic	27708008
NDH2_YEAST	NDE2	genetic	27708008
TPS2_YEAST	TPS2	genetic	27708008
MET32_YEAST	MET32	genetic	27708008
INM2_YEAST	INM2	genetic	27708008
SXM1_YEAST	SXM1	genetic	27708008
VPS60_YEAST	VPS60	genetic	27708008
STL1_YEAST	STL1	genetic	27708008
RS26B_YEAST	RPS26B	genetic	27708008
FMP32_YEAST	FMP32	genetic	27708008
EMP47_YEAST	EMP47	genetic	27708008
ATC1_YEAST	PMR1	genetic	27708008
HUR1_YEAST	HUR1	genetic	27708008
VPS9_YEAST	VPS9	genetic	27708008
YM100_YEAST	YML100W-A	genetic	27708008
SAS2_YEAST	SAS2	genetic	27708008
FUS2_YEAST	FUS2	genetic	27708008
COX7_YEAST	COX7	genetic	27708008
CISY1_YEAST	CIT1	genetic	27708008
VHS3_YEAST	VHS3	genetic	27708008
VPS21_YEAST	VPS21	genetic	27708008
PEX27_YEAST	PEX27	genetic	27708008
MCP1_YEAST	MCP1	genetic	27708008
HRK1_YEAST	HRK1	genetic	27708008
BUD7_YEAST	BUD7	genetic	27708008
RAD1_YEAST	RAD1	genetic	27708008
SVL3_YEAST	SVL3	genetic	27708008
KES1_YEAST	KES1	genetic	27708008
MRL1_YEAST	MRL1	genetic	27708008
ARR3_YEAST	ARR3	genetic	27708008
CR3L1_HUMAN	CREB3L1	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VPS55_YEAST

Related Literatures of Post-Translational Modification