| UniProt ID | ARR3_YEAST | |
|---|---|---|
| UniProt AC | Q06598 | |
| Protein Name | Arsenical-resistance protein 3 {ECO:0000305} | |
| Gene Name | ARR3 {ECO:0000312|SGD:S000006405} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 404 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
| Protein Description | Plasma membrane transporter that confers resistance to toxic metalloids by mediating extrusion of arsenite (As(III)) and antimonite (Sb(III)) out of cells. Displays low-affinity As(III)/H(+) and Sb(III)/H(+) exchange activity.. | |
| Protein Sequence | MSEDQKSENSVPSKVNMVNRTDILTTIKSLSWLDLMLPFTIILSIIIAVIISVYVPSSRHTFDAEGHPNLMGVSIPLTVGMIVMMIPPICKVSWESIHKYFYRSYIRKQLALSLFLNWVIGPLLMTALAWMALFDYKEYRQGIIMIGVARCIAMVLIWNQIAGGDNDLCVVLVITNSLLQMVLYAPLQIFYCYVISHDHLNTSNRVLFEEVAKSVGVFLGIPLGIGIIIRLGSLTIAGKSNYEKYILRFISPWAMIGFHYTLFVIFISRGYQFIHEIGSAILCFVPLVLYFFIAWFLTFALMRYLSISRSDTQRECSCDQELLLKRVWGRKSCEASFSITMTQCFTMASNNFELSLAIAISLYGNNSKQAIAATFGPLLEVPILLILAIVARILKPYYIWNNRN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Ubiquitination | --MSEDQKSENSVPS --CCHHHCCCCCCCC | 72.55 | 23749301 | |
| 201 | N-linked_Glycosylation | VISHDHLNTSNRVLF HHCCCCCCCCCCHHH | 37.73 | - | |
| 325 | Ubiquitination | CDQELLLKRVWGRKS CCHHHHHHHHHCCCC | 44.89 | 23749301 | |
| 365 | N-linked_Glycosylation | IAISLYGNNSKQAIA HHHHHHCCCHHHHHH | 35.72 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARR3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARR3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARR3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
