UniProt ID | TDA4_YEAST | |
---|---|---|
UniProt AC | P47153 | |
Protein Name | Topoisomerase I damage affected protein 4 | |
Gene Name | TDA4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 279 | |
Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
Protein Description | ||
Protein Sequence | MNANSTTTAIGLTSPFEKLSFFPHSSNLILAHLHEIIFSFVFYQLAFSVVAPFLNKVVFRKHYTTIRDPLLKIDFNVHTVSMIQAVVSNTVLLPTLTTPMHYNVVTYTDSYSSMVSSLSAGYFIWDLTMCVRYFKLYGLEFTGHAIGSVYVMLLSLRPFCQPWIGRFLIYEASTPFVNINWFIMQCNAKSKNSIPLWFNVVNGLLLMTVFFVVRICWGSIASALLFRQMWKVRDELPKFSAVTMMSLNIFMNLLNVLWFKKMIRIAKKLAKPAPTSKLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MNANSTTTAIGL ---CCCCCCCCCCCC | 25.39 | 22890988 | |
6 | Phosphorylation | --MNANSTTTAIGLT --CCCCCCCCCCCCC | 28.15 | 22890988 | |
7 | Phosphorylation | -MNANSTTTAIGLTS -CCCCCCCCCCCCCC | 17.66 | 22890988 | |
8 | Phosphorylation | MNANSTTTAIGLTSP CCCCCCCCCCCCCCC | 19.16 | 22890988 | |
13 | Phosphorylation | TTTAIGLTSPFEKLS CCCCCCCCCCCHHHC | 29.19 | 22890988 | |
14 | Phosphorylation | TTAIGLTSPFEKLSF CCCCCCCCCCHHHCC | 32.41 | 22890988 | |
276 | Phosphorylation | LAKPAPTSKLD---- HCCCCCCCCCC---- | 30.11 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TDA4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TDA4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TDA4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRS2_YEAST | SRS2 | genetic | 21459050 | |
AIF1_YEAST | AIF1 | genetic | 26752183 | |
COX12_YEAST | COX12 | genetic | 26752183 | |
MCA1_YEAST | MCA1 | genetic | 26752183 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
DPOA2_YEAST | POL12 | genetic | 27708008 | |
KPC1_YEAST | PKC1 | genetic | 27708008 | |
TIM22_YEAST | TIM22 | genetic | 27708008 | |
CDC1_YEAST | CDC1 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
STT3_YEAST | STT3 | genetic | 27708008 | |
SED5_YEAST | SED5 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
BET5_YEAST | BET5 | genetic | 27708008 | |
PSB5_YEAST | PRE2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...