| UniProt ID | YPT7_YEAST | |
|---|---|---|
| UniProt AC | P32939 | |
| Protein Name | GTP-binding protein YPT7 | |
| Gene Name | YPT7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 208 | |
| Subcellular Localization | Vacuole. | |
| Protein Description | Needed for homotypic vacuole fusion, the last step in the vacuole inheritance process.. | |
| Protein Sequence | MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAINIRLDGENNSCSC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Ubiquitination | LGDSGVGKTSLMHRY ECCCCCCHHHHHHHH | 32.31 | 23749301 | |
| 32 | Acetylation | MHRYVNDKYSQQYKA HHHHHCHHHHHHHEE | 41.41 | 22865919 | |
| 32 | Ubiquitination | MHRYVNDKYSQQYKA HHHHHCHHHHHHHEE | 41.41 | 23749301 | |
| 38 | Ubiquitination | DKYSQQYKATIGADF HHHHHHHEEEECCCE | 34.41 | 24961812 | |
| 48 | Ubiquitination | IGADFLTKEVTVDGD ECCCEEEEEEEECCC | 52.94 | 24961812 | |
| 56 | Ubiquitination | EVTVDGDKVATMQVW EEEECCCEEEEEEEE | 39.02 | 23749301 | |
| 73 | Phosphorylation | AGQERFQSLGVAFYR CCHHHHHHHCCCHHC | 25.12 | 22369663 | |
| 79 | Phosphorylation | QSLGVAFYRGADCCV HHHCCCHHCCCCEEE | 9.82 | 22369663 | |
| 135 | Ubiquitination | IDAEESKKIVSEKSA CCHHHHHHHCCHHHH | 58.58 | 22817900 | |
| 140 | 2-Hydroxyisobutyrylation | SKKIVSEKSAQELAK HHHHCCHHHHHHHHH | 43.51 | - | |
| 140 | Ubiquitination | SKKIVSEKSAQELAK HHHHCCHHHHHHHHH | 43.51 | 23749301 | |
| 141 | Phosphorylation | KKIVSEKSAQELAKS HHHCCHHHHHHHHHH | 31.00 | 23749301 | |
| 147 | Ubiquitination | KSAQELAKSLGDIPL HHHHHHHHHHCCCHH | 59.86 | 23749301 | |
| 147 | Acetylation | KSAQELAKSLGDIPL HHHHHHHHHHCCCHH | 59.86 | 24489116 | |
| 148 | Phosphorylation | SAQELAKSLGDIPLF HHHHHHHHHCCCHHH | 31.79 | 22369663 | |
| 175 | Phosphorylation | AFEEIARSALQQNQA HHHHHHHHHHHHCHH | 25.06 | 28132839 | |
| 206 | Geranylgeranylation | LDGENNSCSC----- ECCCCCCCCC----- | 5.38 | - | |
| 208 | Methylation | GENNSCSC------- CCCCCCCC------- | 8.30 | - | |
| 208 | Geranylgeranylation | GENNSCSC------- CCCCCCCC------- | 8.30 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPT7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPT7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPT7_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
