UniProt ID | YD056_YEAST | |
---|---|---|
UniProt AC | Q12025 | |
Protein Name | Uncharacterized protein YDR056C | |
Gene Name | YDR056C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 205 | |
Subcellular Localization | Endoplasmic reticulum . | |
Protein Description | ||
Protein Sequence | MLVRLLRVILLASMVFCADILQLSYSDDAKDAIPLGTFEIDSTSDGNVTVTTVNIQDVEVSGEYCLNAQIEGKLDMPCFSYMKLRTPLKYDLIVDVDEDNEVKQVSLSYDETNDAITATVRYPEAGPTAPVTKLKKKTKTYADKKASKNKDGSTAQFEEDEEVKEVSWFQKNWKMLLLGLLIYNFVAGSAKKQQQGGAGADQKTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YD056_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD056_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD056_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD056_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TSC3_YEAST | TSC3 | genetic | 16269340 | |
PMT4_YEAST | PMT4 | genetic | 16269340 | |
VPS52_YEAST | VPS52 | genetic | 16269340 | |
RPN4_YEAST | RPN4 | genetic | 19325107 | |
VPS52_YEAST | VPS52 | genetic | 19325107 | |
VPS53_YEAST | VPS53 | genetic | 19325107 | |
HOP2_YEAST | HOP2 | genetic | 19325107 | |
RS8A_YEAST | RPS8A | genetic | 27708008 | |
RS8B_YEAST | RPS8A | genetic | 27708008 | |
SIF2_YEAST | SIF2 | genetic | 27708008 | |
METE_YEAST | MET6 | genetic | 27708008 | |
AIM11_YEAST | AIM11 | genetic | 27708008 | |
RIM15_YEAST | RIM15 | genetic | 27708008 | |
SA155_YEAST | SAP155 | genetic | 27708008 | |
YG036_YEAST | YGL036W | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
VMA21_YEAST | VMA21 | genetic | 27708008 | |
TBP7_YEAST | YTA7 | genetic | 27708008 | |
SLT2_YEAST | SLT2 | genetic | 27708008 | |
MET28_YEAST | MET28 | genetic | 27708008 | |
PIR5_YEAST | YJL160C | genetic | 27708008 | |
DBP7_YEAST | DBP7 | genetic | 27708008 | |
BPT1_YEAST | BPT1 | genetic | 27708008 | |
ACE2_YEAST | ACE2 | genetic | 27708008 | |
HDA1_YEAST | HDA1 | genetic | 27708008 | |
ADE_YEAST | AAH1 | genetic | 27708008 | |
DCAM_YEAST | SPE2 | genetic | 27708008 | |
INO4_YEAST | INO4 | genetic | 27708008 | |
GAS4_YEAST | GAS4 | genetic | 27708008 | |
RKM1_YEAST | RKM1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...