| UniProt ID | YD056_YEAST | |
|---|---|---|
| UniProt AC | Q12025 | |
| Protein Name | Uncharacterized protein YDR056C | |
| Gene Name | YDR056C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 205 | |
| Subcellular Localization | Endoplasmic reticulum . | |
| Protein Description | ||
| Protein Sequence | MLVRLLRVILLASMVFCADILQLSYSDDAKDAIPLGTFEIDSTSDGNVTVTTVNIQDVEVSGEYCLNAQIEGKLDMPCFSYMKLRTPLKYDLIVDVDEDNEVKQVSLSYDETNDAITATVRYPEAGPTAPVTKLKKKTKTYADKKASKNKDGSTAQFEEDEEVKEVSWFQKNWKMLLLGLLIYNFVAGSAKKQQQGGAGADQKTE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YD056_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD056_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD056_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD056_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TSC3_YEAST | TSC3 | genetic | 16269340 | |
| PMT4_YEAST | PMT4 | genetic | 16269340 | |
| VPS52_YEAST | VPS52 | genetic | 16269340 | |
| RPN4_YEAST | RPN4 | genetic | 19325107 | |
| VPS52_YEAST | VPS52 | genetic | 19325107 | |
| VPS53_YEAST | VPS53 | genetic | 19325107 | |
| HOP2_YEAST | HOP2 | genetic | 19325107 | |
| RS8A_YEAST | RPS8A | genetic | 27708008 | |
| RS8B_YEAST | RPS8A | genetic | 27708008 | |
| SIF2_YEAST | SIF2 | genetic | 27708008 | |
| METE_YEAST | MET6 | genetic | 27708008 | |
| AIM11_YEAST | AIM11 | genetic | 27708008 | |
| RIM15_YEAST | RIM15 | genetic | 27708008 | |
| SA155_YEAST | SAP155 | genetic | 27708008 | |
| YG036_YEAST | YGL036W | genetic | 27708008 | |
| ASK10_YEAST | ASK10 | genetic | 27708008 | |
| VMA21_YEAST | VMA21 | genetic | 27708008 | |
| TBP7_YEAST | YTA7 | genetic | 27708008 | |
| SLT2_YEAST | SLT2 | genetic | 27708008 | |
| MET28_YEAST | MET28 | genetic | 27708008 | |
| PIR5_YEAST | YJL160C | genetic | 27708008 | |
| DBP7_YEAST | DBP7 | genetic | 27708008 | |
| BPT1_YEAST | BPT1 | genetic | 27708008 | |
| ACE2_YEAST | ACE2 | genetic | 27708008 | |
| HDA1_YEAST | HDA1 | genetic | 27708008 | |
| ADE_YEAST | AAH1 | genetic | 27708008 | |
| DCAM_YEAST | SPE2 | genetic | 27708008 | |
| INO4_YEAST | INO4 | genetic | 27708008 | |
| GAS4_YEAST | GAS4 | genetic | 27708008 | |
| RKM1_YEAST | RKM1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...