dbPTM

GAS4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GAS4_YEAST
UniProt AC	Q08271
Protein Name	1,3-beta-glucanosyltransferase GAS4
Gene Name	GAS4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	471
Subcellular Localization	Cell membrane Lipid-anchor, GPI-anchor .
Protein Description	Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in spore wall assembly..
Protein Sequence	MMVFSSTFIFLILELVVLCEASVHTIQIKDKHFVDTVTGKPFFIKGVDYQPGGSSDVSEKQDPLSNPDACARDILLFQELGINTVRIYSINPDLNHDACMTMLAMAGIYLILDVNSPLQNQHLNRYEPWTTYNEVYLEHVFKVVEQFSHYNNTLGFFAGNEIVNDKRSAQYSPAYVKELIGTMKNYISAHSPRTIPVGYSAADDLNYRVSLSEYLECKDDDKPENSVDFYGVNSYQWCGQQTMQTSGYDTLVDAYRSYSKPVFFSEFGCNKVLPRQFQEIGYLFSEEMYSVFCGGLVYEFSQEDNNYGLVEYQEDDSVQLLADFEKLKSHYQNIEFPSMKTLKETVQMEETPSCAEDYENLKIESKIAKNLGSSLIKKGVKVEKGKYIDIHEDQLSTNVTILDKHGDRWNGPKKIEIRQSLTLADLEGEEQEDADEDKDDLKRKHRNSASISGPLLPLGLCLLFFTFSLFF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
151	N-linked_Glycosylation	VEQFSHYNNTLGFFA HHHHCCCCCCCEEEC	29.59	-
200	Phosphorylation	RTIPVGYSAADDLNY CCCCCCCCHHHCCCC	15.85	28889911
398	N-linked_Glycosylation	HEDQLSTNVTILDKH CHHHCCCCEEEEECC	26.09	-
447	GPI-anchor	DLKRKHRNSASISGP HHHHHHHHCCCCCCC	41.46	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GAS4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GAS4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GAS4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PHO88_YEAST	PHO88	physical	16093310
MKAR_YEAST	IFA38	physical	16093310
YPC1_YEAST	YPC1	physical	16093310
KTR4_YEAST	KTR4	physical	16093310
FTH1_YEAST	FTH1	physical	16093310
PMP1_YEAST	PMP1	physical	16093310
ELO2_YEAST	ELO2	physical	16093310
OST4_YEAST	OST4	physical	16093310
FCY2_YEAST	FCY2	physical	16093310
FCY22_YEAST	FCY22	physical	16093310
ERV29_YEAST	ERV29	physical	16093310
YHU0_YEAST	YHR140W	physical	16093310
SYG1_YEAST	SYG1	physical	16093310
SEC11_YEAST	SEC11	physical	16093310
NSP1_YEAST	NSP1	physical	16093310
ELO3_YEAST	ELO3	physical	16093310
GSF2_YEAST	GSF2	physical	16093310
YHM2_YEAST	YHM2	physical	16093310
RCE1_YEAST	RCE1	physical	16093310
VDAC1_YEAST	POR1	physical	16093310
TLG2_YEAST	TLG2	physical	16093310
ERP4_YEAST	ERP4	physical	16093310
KTR1_YEAST	KTR1	physical	16093310
SAM3_YEAST	SAM3	physical	16093310
THRC_YEAST	THR4	genetic	27708008
CHK1_YEAST	CHK1	genetic	27708008
ATC4_YEAST	DNF2	genetic	27708008
INO2_YEAST	INO2	genetic	27708008
RV167_YEAST	RVS167	genetic	27708008
CP56_YEAST	DIT2	genetic	27708008
6PGD2_YEAST	GND2	genetic	27708008
NPT1_YEAST	NPT1	genetic	27708008
ELP3_YEAST	ELP3	genetic	27708008
FLC1_YEAST	FLC1	genetic	27708008
YP078_YEAST	YPR078C	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GAS4_YEAST

Related Literatures of Post-Translational Modification