| UniProt ID | PMP1_YEAST | |
|---|---|---|
| UniProt AC | P32903 | |
| Protein Name | Plasma membrane ATPase proteolipid 1 | |
| Gene Name | PMP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 40 | |
| Subcellular Localization | Cell membrane. | |
| Protein Description | ||
| Protein Sequence | MTLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PMP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PMP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PMP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PMP1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MKAR_YEAST | IFA38 | physical | 16093310 | |
| SHR3_YEAST | SHR3 | physical | 16093310 | |
| ERV29_YEAST | ERV29 | physical | 16093310 | |
| ELO3_YEAST | ELO3 | physical | 16093310 | |
| ALG5_YEAST | ALG5 | physical | 16093310 | |
| GET2_YEAST | GET2 | genetic | 19325107 | |
| GLO3_YEAST | GLO3 | genetic | 19325107 | |
| PER1_YEAST | PER1 | genetic | 19325107 | |
| ARL1_YEAST | ARL1 | genetic | 19325107 | |
| SAC1_YEAST | SAC1 | genetic | 20526336 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 | |
| ATPA_YEAST | ATP1 | genetic | 21623372 | |
| COX6_YEAST | COX6 | genetic | 21623372 | |
| QCR7_YEAST | QCR7 | genetic | 21623372 | |
| IPT1_YEAST | IPT1 | genetic | 21623372 | |
| ADE_YEAST | AAH1 | genetic | 21623372 | |
| SDHX_YEAST | YJL045W | genetic | 21623372 | |
| DCE_YEAST | GAD1 | genetic | 21623372 | |
| GPP2_YEAST | GPP2 | genetic | 21623372 | |
| GSH1_YEAST | GSH1 | genetic | 21623372 | |
| KPR4_YEAST | PRS4 | genetic | 21623372 | |
| HSP71_YEAST | SSA1 | physical | 22940862 | |
| PYR1_YEAST | URA2 | physical | 22940862 | |
| FKS1_YEAST | FKS1 | physical | 22940862 | |
| DED1_YEAST | DED1 | physical | 22940862 | |
| PMA1_YEAST | PMA1 | physical | 22940862 | |
| SSB1_YEAST | SSB1 | physical | 22940862 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...