| UniProt ID | COX6_YEAST | |
|---|---|---|
| UniProt AC | P00427 | |
| Protein Name | Cytochrome c oxidase subunit 6, mitochondrial | |
| Gene Name | COX6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 148 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | This is the heme A-containing chain of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
| Protein Sequence | MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 58 | Acetylation | EFTARYEKEFDEAYD HHHHHHHHHHHHHHH | 55.54 | 24489116 | |
| 112 | Acetylation | IRVFEALKYKVENED HHHHHHHHHCCCCHH | 50.50 | 24489116 | |
| 122 | Acetylation | VENEDQYKAYLDELK CCCHHHHHHHHHHHH | 25.56 | 24489116 | |
| 129 | Acetylation | KAYLDELKDVRQELG HHHHHHHHHHHHHHC | 52.72 | 24489116 | |
| 146 | Phosphorylation | LKEELFPSSS----- CCHHHCCCCC----- | 35.56 | 27017623 | |
| 148 | Phosphorylation | EELFPSSS------- HHHCCCCC------- | 48.88 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX6_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
