| UniProt ID | CWP1_YEAST | |
|---|---|---|
| UniProt AC | P28319 | |
| Protein Name | Cell wall protein CWP1 | |
| Gene Name | CWP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 239 | |
| Subcellular Localization |
Secreted, cell wall. Membrane Lipid-anchor, GPI-anchor. Identified as covalently-linked GPI-modified cell wall protein (GPI-CWP) as well as protein covalently linked via an alkali-sensitive bond not requiring the GPI-derived structure. Can also be d |
|
| Protein Description | Component of the cell wall.. | |
| Protein Sequence | MKFSTALSVALFALAKMVIADSEEFGLVSIRSGSDLQYLSVYSDNGTLKLGSGSGSFEATITDDGKLKFDDDKYAVVNEDGSFKEGSESDAATGFSIKDGHLNYKSSSGFYAIKDGSSYIFSSKQSDDATGVAIRPTSKSGSVAADFSPSDSSSSSSASASSASASSSTKHSSSIESVETSTTVETSSASSPTASVISQITDGQIQAPNTVYEQTENAGAKAAVGMGAGALAVAAAYLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Phosphorylation | NGTLKLGSGSGSFEA CCEEEECCCCCCEEE | 39.98 | 27017623 | |
| 56 | Phosphorylation | KLGSGSGSFEATITD EECCCCCCEEEEECC | 22.93 | 27017623 | |
| 62 | Phosphorylation | GSFEATITDDGKLKF CCEEEEECCCCCEEE | 24.55 | 27017623 | |
| 138 | Phosphorylation | GVAIRPTSKSGSVAA CEEEEECCCCCCEEE | 27.75 | 27214570 | |
| 217 | GPI-anchor | TVYEQTENAGAKAAV CCCHHCCCCCHHHHH | 47.24 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWP1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CWP2_YEAST | CWP2 | genetic | 18281714 | |
| CWP2_YEAST | CWP2 | genetic | 9758839 | |
| RU1C_YEAST | YHC1 | genetic | 27708008 | |
| TAF12_YEAST | TAF12 | genetic | 27708008 | |
| TCPZ_YEAST | CCT6 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| FIP1_YEAST | FIP1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
