UniProt ID | PAU17_YEAST | |
---|---|---|
UniProt AC | Q12370 | |
Protein Name | Seripauperin-17 | |
Gene Name | PAU17 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 124 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVKLTSIAAGVAAIAAGVAAAPATTTLSPSDERVNLVELGVYVSDIRAHLAEYYMFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSTRLRPAISSALSADGIYTAVPN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU17_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU17_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU17_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU17_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STE50_YEAST | STE50 | genetic | 20093466 | |
SNF6_YEAST | SNF6 | genetic | 20093466 | |
SAC1_YEAST | SAC1 | genetic | 20093466 | |
DCOR_YEAST | SPE1 | genetic | 20093466 | |
ELM1_YEAST | ELM1 | genetic | 20093466 | |
RCO1_YEAST | RCO1 | genetic | 20093466 | |
DCAM_YEAST | SPE2 | genetic | 20093466 | |
ELM1_YEAST | ELM1 | genetic | 22282571 | |
STE50_YEAST | STE50 | genetic | 27708008 | |
RV161_YEAST | RVS161 | genetic | 27708008 | |
SNF6_YEAST | SNF6 | genetic | 27708008 | |
ELM1_YEAST | ELM1 | genetic | 27708008 | |
DCOR_YEAST | SPE1 | genetic | 27708008 | |
DCAM_YEAST | SPE2 | genetic | 27708008 | |
RL21B_YEAST | RPL21B | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...