dbPTM

SOP4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SOP4_YEAST
UniProt AC	P39543
Protein Name	Protein SOP4
Gene Name	SOP4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	234
Subcellular Localization	Endoplasmic reticulum membrane Single-pass type I membrane protein .
Protein Description	Involved in the export of PMA1, possibly through the monitoring or assisting of PMA1 folding and acquisition of competence to enter vesicles..
Protein Sequence	MFSQIVLLLSAFIYVASATARRGTIKGRLDLAASNITGFVSTRTSFKLYQIGNFSTEYPYTSTTMFQDDEGNFEFANLPLNDGVNETTYYVMYPASMDFNLKPNRILIEFKNLENGTLQLNAFKNFFGREYFPSKDITYPEKLQSMKVHPYITVELLHKAPIRSYLQARNVSIFSTGIVGNILNSRWKLAGVITLIALVVFPIIVEKLDPETARAIREEAKRKQREKYAAVASK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	N-linked_Glycosylation	RLDLAASNITGFVST HHHHHHHCCCEEEEE	30.99	-
53	N-linked_Glycosylation	FKLYQIGNFSTEYPY EEEEEECCEECCCCC	29.35	-
85	N-linked_Glycosylation	LPLNDGVNETTYYVM EECCCCCCCEEEEEE	46.56	-
115	N-linked_Glycosylation	IEFKNLENGTLQLNA EEEEECCCCEEEEHH	52.49	-
142	Acetylation	KDITYPEKLQSMKVH CCCCCCHHHHHCCCC	47.53	24489116
170	N-linked_Glycosylation	RSYLQARNVSIFSTG HHHHHHCCCEEEECC	34.60	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SOP4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SOP4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SOP4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSH1_YEAST	SSH1	genetic	16269340
SCS7_YEAST	SCS7	genetic	16269340
CHO2_YEAST	CHO2	genetic	16269340
SUR2_YEAST	SUR2	genetic	16269340
BFR1_YEAST	BFR1	genetic	16269340
PFD2_YEAST	GIM4	genetic	16269340
ILM1_YEAST	ILM1	genetic	16269340
PDR12_YEAST	PDR12	physical	18467557
ORM2_YEAST	ORM2	physical	18467557
ATG8_YEAST	ATG8	genetic	20093466
KCC4_YEAST	KCC4	genetic	20093466
YD180_YEAST	YDL180W	genetic	20093466
ATG9_YEAST	ATG9	genetic	20093466
ATG1_YEAST	ATG1	genetic	20093466
MET7_YEAST	STR2	genetic	20093466
MRT4_YEAST	MRT4	genetic	20093466
VPS9_YEAST	VPS9	genetic	20093466
YPT7_YEAST	YPT7	genetic	20093466
RS7B_YEAST	RPS7B	genetic	20093466
EOS1_YEAST	EOS1	genetic	20093466
BRE5_YEAST	BRE5	genetic	20093466
TLG2_YEAST	TLG2	genetic	20093466
ATG13_YEAST	ATG13	genetic	20093466
VPS51_YEAST	VPS51	genetic	19325107
SSH1_YEAST	SSH1	genetic	19325107
PDR12_YEAST	PDR12	physical	22615397
ATG1_YEAST	ATG1	genetic	22282571
ATG8_YEAST	ATG8	genetic	27708008
RPN4_YEAST	RPN4	genetic	27708008
VAM6_YEAST	VAM6	genetic	27708008
ATG9_YEAST	ATG9	genetic	27708008
GET2_YEAST	GET2	genetic	27708008
ATG1_YEAST	ATG1	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
DAL81_YEAST	DAL81	genetic	27708008
NNK1_YEAST	NNK1	genetic	27708008
YPT7_YEAST	YPT7	genetic	27708008
VPS9_YEAST	VPS9	genetic	27708008
RS7B_YEAST	RPS7B	genetic	27708008
BRE5_YEAST	BRE5	genetic	27708008
BECN1_YEAST	VPS30	genetic	27708008
MED1_YEAST	MED1	genetic	27708008
ATG13_YEAST	ATG13	genetic	27708008
INO2_YEAST	INO2	genetic	29674565
CHO2_YEAST	CHO2	genetic	29674565
RS21A_YEAST	RPS21A	genetic	29674565
MED10_YEAST	NUT2	genetic	29674565
ICE2_YEAST	ICE2	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SOP4_YEAST

Related Literatures of Post-Translational Modification