UniProt ID | RS7B_YEAST | |
---|---|---|
UniProt AC | P48164 | |
Protein Name | 40S ribosomal protein S7-B {ECO:0000303|PubMed:9559554} | |
Gene Name | RPS7B {ECO:0000303|PubMed:9559554} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 190 | |
Subcellular Localization | Cytoplasm . Nucleus, nucleolus . | |
Protein Description | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. [PubMed: 22096102 eS7 is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly] | |
Protein Sequence | MSSVQSKILSQAPSELELQVAKTFIDLESSSPELKADLRPLQIKSIREIDVTGGKKALVLFVPVPALSAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTAVHDKVLEDMVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPSQTN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSVQSKIL ------CCHHHHHHH | 38.94 | 10601260 | |
2 | Phosphorylation | ------MSSVQSKIL ------CCHHHHHHH | 38.94 | 27717283 | |
3 | Phosphorylation | -----MSSVQSKILS -----CCHHHHHHHH | 23.91 | 30377154 | |
6 | Phosphorylation | --MSSVQSKILSQAP --CCHHHHHHHHCCC | 21.36 | 30377154 | |
7 | Ubiquitination | -MSSVQSKILSQAPS -CCHHHHHHHHCCCC | 30.49 | 24961812 | |
10 | Phosphorylation | SVQSKILSQAPSELE HHHHHHHHCCCCHHH | 27.98 | 22369663 | |
14 | Phosphorylation | KILSQAPSELELQVA HHHHCCCCHHHHHHH | 58.80 | 22369663 | |
22 | Ubiquitination | ELELQVAKTFIDLES HHHHHHHHHHCCCCC | 45.15 | 23749301 | |
23 | Phosphorylation | LELQVAKTFIDLESS HHHHHHHHHCCCCCC | 18.98 | 25521595 | |
29 | Phosphorylation | KTFIDLESSSPELKA HHHCCCCCCCHHHCC | 43.33 | 22369663 | |
30 | Phosphorylation | TFIDLESSSPELKAD HHCCCCCCCHHHCCC | 40.30 | 25521595 | |
31 | Phosphorylation | FIDLESSSPELKADL HCCCCCCCHHHCCCC | 31.50 | 22369663 | |
35 | Acetylation | ESSSPELKADLRPLQ CCCCHHHCCCCCCCC | 37.89 | 24489116 | |
35 | Succinylation | ESSSPELKADLRPLQ CCCCHHHCCCCCCCC | 37.89 | 23954790 | |
35 | Ubiquitination | ESSSPELKADLRPLQ CCCCHHHCCCCCCCC | 37.89 | 23749301 | |
44 | Acetylation | DLRPLQIKSIREIDV CCCCCCCCEEEEEEC | 27.20 | 24489116 | |
44 | Ubiquitination | DLRPLQIKSIREIDV CCCCCCCCEEEEEEC | 27.20 | 23749301 | |
52 | Phosphorylation | SIREIDVTGGKKALV EEEEEECCCCCEEEE | 36.15 | 21440633 | |
55 | Succinylation | EIDVTGGKKALVLFV EEECCCCCEEEEEEE | 35.90 | 23954790 | |
56 | Ubiquitination | IDVTGGKKALVLFVP EECCCCCEEEEEEEE | 50.67 | 23749301 | |
68 | Phosphorylation | FVPVPALSAYHKVQT EEECCHHHHHHHHHH | 28.96 | 21440633 | |
72 | Ubiquitination | PALSAYHKVQTKLTR CHHHHHHHHHHHHHH | 24.30 | 22817900 | |
72 | Acetylation | PALSAYHKVQTKLTR CHHHHHHHHHHHHHH | 24.30 | 24489116 | |
75 | Phosphorylation | SAYHKVQTKLTRELE HHHHHHHHHHHHHHH | 30.89 | 23749301 | |
76 | Ubiquitination | AYHKVQTKLTRELEK HHHHHHHHHHHHHHH | 30.67 | 23749301 | |
83 | Ubiquitination | KLTRELEKKFPDRHV HHHHHHHHHCCCCEE | 72.79 | 22817900 | |
84 | Ubiquitination | LTRELEKKFPDRHVI HHHHHHHHCCCCEEE | 53.40 | 22817900 | |
103 | Phosphorylation | RRILPKPSRTSRQVQ CCCCCCCCCCCHHHH | 55.08 | 30377154 | |
106 | Phosphorylation | LPKPSRTSRQVQKRP CCCCCCCCHHHHHCC | 21.43 | 30377154 | |
115 | Phosphorylation | QVQKRPRSRTLTAVH HHHHCCCCCCCHHHC | 32.09 | 22369663 | |
117 | Phosphorylation | QKRPRSRTLTAVHDK HHCCCCCCCHHHCHH | 29.70 | 22369663 | |
119 | Phosphorylation | RPRSRTLTAVHDKVL CCCCCCCHHHCHHHH | 26.48 | 22369663 | |
124 | Acetylation | TLTAVHDKVLEDMVF CCHHHCHHHHHHCCC | 33.56 | 24489116 | |
124 | Ubiquitination | TLTAVHDKVLEDMVF CCHHHCHHHHHHCCC | 33.56 | 17644757 | |
138 | Ubiquitination | FPTEIVGKRVRYLVG CCHHHCCCEEEEEEC | 36.50 | 23749301 | |
142 | Phosphorylation | IVGKRVRYLVGGNKI HCCCEEEEEECCCCC | 11.68 | 21440633 | |
148 | Ubiquitination | RYLVGGNKIQKVLLD EEEECCCCCEEEECC | 50.19 | 23749301 | |
151 | Ubiquitination | VGGNKIQKVLLDSKD ECCCCCEEEECCCCC | 38.02 | 23749301 | |
156 | Phosphorylation | IQKVLLDSKDVQQID CEEEECCCCCHHHHH | 30.63 | 23749301 | |
157 | Ubiquitination | QKVLLDSKDVQQIDY EEEECCCCCHHHHHH | 62.68 | 23749301 | |
165 | Ubiquitination | DVQQIDYKLESFQAV CHHHHHHHHHHHHHH | 41.87 | 24961812 | |
168 | Phosphorylation | QIDYKLESFQAVYNK HHHHHHHHHHHHHHH | 32.85 | 30377154 | |
175 | Ubiquitination | SFQAVYNKLTGKQIV HHHHHHHHHCCCEEE | 29.73 | 23749301 | |
179 | Ubiquitination | VYNKLTGKQIVFEIP HHHHHCCCEEEEECC | 31.45 | 23749301 | |
187 | Phosphorylation | QIVFEIPSQTN---- EEEEECCCCCC---- | 56.13 | 28152593 | |
189 | Phosphorylation | VFEIPSQTN------ EEECCCCCC------ | 47.43 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS7B_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS7B_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS7B_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"The action of N-terminal acetyltransferases on yeast ribosomalproteins."; Arnold R.J., Polevoda B., Reilly J.P., Sherman F.; J. Biol. Chem. 274:37035-37040(1999). Cited for: CLEAVAGE OF INITIATOR METHIONINE, AND ACETYLATION AT SER-2 BY NATA. | |
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10; SER-14; SER-31;SER-115; THR-119 AND SER-156, AND MASS SPECTROMETRY. | |
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-115 AND THR-117, ANDMASS SPECTROMETRY. | |
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31, AND MASSSPECTROMETRY. | |
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31, AND MASSSPECTROMETRY. |