| UniProt ID | IZH2_YEAST | |
|---|---|---|
| UniProt AC | Q12442 | |
| Protein Name | ADIPOR-like receptor IZH2 | |
| Gene Name | IZH2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 317 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | Probable receptor, which is involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation.. | |
| Protein Sequence | MSTLLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNSYELVHIKMENGIVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MSTLLERTKSVQELK CCHHHHHHHHHHHHH | 20.49 | 24961812 | |
| 9 | Ubiquitination | STLLERTKSVQELKK CHHHHHHHHHHHHHH | 55.65 | 23749301 | |
| 10 | Phosphorylation | TLLERTKSVQELKKR HHHHHHHHHHHHHHH | 28.55 | 23749301 | |
| 15 | Ubiquitination | TKSVQELKKRAAGKT HHHHHHHHHHHCCCC | 39.19 | 22817900 | |
| 16 | Ubiquitination | KSVQELKKRAAGKTS HHHHHHHHHHCCCCC | 60.95 | 22817900 | |
| 21 | Ubiquitination | LKKRAAGKTSANPAE HHHHHCCCCCCCHHH | 34.28 | 23749301 | |
| 31 | Ubiquitination | ANPAEVAKAKKVLRR CCHHHHHHHHHHHHH | 66.95 | 23749301 | |
| 33 | Ubiquitination | PAEVAKAKKVLRRLY HHHHHHHHHHHHHHC | 42.58 | 22817900 | |
| 34 | Ubiquitination | AEVAKAKKVLRRLYS HHHHHHHHHHHHHCC | 51.89 | 22817900 | |
| 40 | Phosphorylation | KKVLRRLYSWDEIPE HHHHHHHCCCCCCCH | 13.10 | 24961812 | |
| 41 | Phosphorylation | KVLRRLYSWDEIPEW HHHHHHCCCCCCCHH | 32.42 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IZH2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IZH2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IZH2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
