UniProt ID | YM58C_YEAST | |
---|---|---|
UniProt AC | Q3E843 | |
Protein Name | Uncharacterized protein YMR158C-A | |
Gene Name | YMR158C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 45 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKMNYHLSTSSYTTSMLSCTVLDDDIRYEKLSWKLDEAEMQGLIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YM58C_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YM58C_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YM58C_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YM58C_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SHE1_YEAST | SHE1 | genetic | 27708008 | |
YCY0_YEAST | YCR090C | genetic | 27708008 | |
MTU1_YEAST | SLM3 | genetic | 27708008 | |
SOK1_YEAST | SOK1 | genetic | 27708008 | |
GTS1_YEAST | GTS1 | genetic | 27708008 | |
SRN2_YEAST | SRN2 | genetic | 27708008 | |
COA4_YEAST | COA4 | genetic | 27708008 | |
MMS22_YEAST | MMS22 | genetic | 27708008 | |
ORM2_YEAST | ORM2 | genetic | 27708008 | |
RS7B_YEAST | RPS7B | genetic | 27708008 | |
HMI1_YEAST | HMI1 | genetic | 27708008 | |
PALA_YEAST | RIM20 | genetic | 27708008 | |
ELP4_YEAST | ELP4 | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 | |
MDL2_YEAST | MDL2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...