YHT8_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YHT8_YEAST
• UniProt AC: P38841
• Protein Name: Uncharacterized protein YHR138C
• Gene Name: YHR138C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 114
• Protein Sequence: MKASYLVLIFISIFSMAQASSLSSYIVTFPKTDNMATDQNSIIEDVKKYVVDIGGKITHEYSLIKGFTVDLPDSDQILDGLKERLSYIESEYGAKCNLEKDSEVHALNRDHLVA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MKASYLVLIFI ----CCHHHHHHHHH	17.30	19823750
5	Phosphorylation	---MKASYLVLIFIS ---CCHHHHHHHHHH	12.99	19823750
12	Phosphorylation	YLVLIFISIFSMAQA HHHHHHHHHHHHHHH	13.56	19823750
15	Phosphorylation	LIFISIFSMAQASSL HHHHHHHHHHHHHCC	16.13	19823750
20	Phosphorylation	IFSMAQASSLSSYIV HHHHHHHHCCHHEEE	21.52	19823750
21	Phosphorylation	FSMAQASSLSSYIVT HHHHHHHCCHHEEEE	34.97	19823750
23	Phosphorylation	MAQASSLSSYIVTFP HHHHHCCHHEEEEEE	24.04	19823750
24	Phosphorylation	AQASSLSSYIVTFPK HHHHCCHHEEEEEEC	24.95	19823750
25	Phosphorylation	QASSLSSYIVTFPKT HHHCCHHEEEEEECC	8.95	19823750
28	Phosphorylation	SLSSYIVTFPKTDNM CCHHEEEEEECCCCC	25.35	19823750
32	Phosphorylation	YIVTFPKTDNMATDQ EEEEEECCCCCCCCC	32.61	19823750
37	Phosphorylation	PKTDNMATDQNSIIE ECCCCCCCCCCCHHH	27.61	22369663
41	Phosphorylation	NMATDQNSIIEDVKK CCCCCCCCHHHHHHH	21.22	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YHT8_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YHT8_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YHT8_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IPB2_YEAST	PBI2	genetic	9657146
LYS12_YEAST	LYS12	physical	16554755
ERB1_YEAST	ERB1	physical	16554755
MCM1_YEAST	MCM1	genetic	27708008
PRP6_YEAST	PRP6	genetic	27708008
NOP14_YEAST	NOP14	genetic	27708008
SWC4_YEAST	SWC4	genetic	27708008
SPC3_YEAST	SPC3	genetic	27708008
CD123_YEAST	CDC123	genetic	27708008
DBP6_YEAST	DBP6	genetic	27708008
DIB1_YEAST	DIB1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-37 AND SER-41, AND MASSSPECTROMETRY.
PubMed: 18407956