UniProt ID | IPB2_YEAST | |
---|---|---|
UniProt AC | P0CT04 | |
Protein Name | Protease B inhibitor 2 | |
Gene Name | PBI2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 75 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Cytosolic inhibitor of vacuolar proteinase B (yscB), probably regulating protease B activity during limited proteolysis. PBI2 is a component of the LMA1 complex, which is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi.. | |
Protein Sequence | MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHEFDIIKGYTIKVPDVLHLNKLKEKHNDVIENVEEDKEVHTN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Ubiquitination | KNFIVTLKKNTPDVE CCEEEEECCCCCCHH | 34.31 | 22817900 | |
11 | Ubiquitination | NFIVTLKKNTPDVEA CEEEEECCCCCCHHH | 69.99 | 23749301 | |
13 | Phosphorylation | IVTLKKNTPDVEAKK EEEECCCCCCHHHHH | 29.73 | 23749301 | |
20 | Ubiquitination | TPDVEAKKFLDSVHH CCCHHHHHHHHHHHH | 59.20 | 24961812 | |
24 | Phosphorylation | EAKKFLDSVHHAGGS HHHHHHHHHHHCCCC | 26.04 | 22369663 | |
31 | Phosphorylation | SVHHAGGSIVHEFDI HHHHCCCCEEEEEEE | 22.11 | 22369663 | |
45 | Acetylation | IIKGYTIKVPDVLHL EECCEEEECCCEECH | 39.66 | 24489116 | |
54 | Acetylation | PDVLHLNKLKEKHND CCEECHHHHHHHCCH | 68.26 | 24489116 | |
58 | Acetylation | HLNKLKEKHNDVIEN CHHHHHHHCCHHHHC | 46.23 | 24489116 | |
70 | Acetylation | IENVEEDKEVHTN-- HHCHHHHCCCCCC-- | 65.99 | 24489116 | |
74 | Phosphorylation | EEDKEVHTN------ HHHCCCCCC------ | 48.04 | 22369663 | |
74 | Phosphorylation | EEDKEVHTN------ HHHCCCCCC------ | 48.04 | 17330950 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IPB2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IPB2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IPB2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SLX5_YEAST | SLX5 | genetic | 27708008 | |
TPS1_YEAST | TPS1 | genetic | 27708008 | |
MGR1_YEAST | MGR1 | genetic | 27708008 | |
BRE1_YEAST | BRE1 | genetic | 27708008 | |
MDHP_YEAST | MDH3 | genetic | 27708008 | |
SAC3_YEAST | SAC3 | genetic | 27708008 | |
UME6_YEAST | UME6 | genetic | 27708008 | |
PEX10_YEAST | PEX10 | genetic | 27708008 | |
CYPD_YEAST | CPR5 | genetic | 27708008 | |
ASK10_YEAST | ASK10 | genetic | 27708008 | |
SDS3_YEAST | SDS3 | genetic | 27708008 | |
OSM1_YEAST | OSM1 | genetic | 27708008 | |
PTK2_YEAST | PTK2 | genetic | 27708008 | |
PAM17_YEAST | PAM17 | genetic | 27708008 | |
BRE2_YEAST | BRE2 | genetic | 27708008 | |
MGR3_YEAST | MGR3 | genetic | 27708008 | |
SCS7_YEAST | SCS7 | genetic | 27708008 | |
SIN3_YEAST | SIN3 | genetic | 27708008 | |
IDH2_YEAST | IDH2 | genetic | 27708008 | |
SFL1_YEAST | SFL1 | genetic | 27708008 | |
PALA_YEAST | RIM20 | genetic | 27708008 | |
MSC6_YEAST | MSC6 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-74, AND MASSSPECTROMETRY. | |
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-74, AND MASSSPECTROMETRY. |