| UniProt ID | PAM17_YEAST | |
|---|---|---|
| UniProt AC | P36147 | |
| Protein Name | Presequence translocated-associated motor subunit PAM17, mitochondrial | |
| Gene Name | PAM17 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 197 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to organize PAM16-PAM18 (TIM16-TIM14) heterodimer.. | |
| Protein Sequence | MFTSAIRLSSQRLFASQPSVTAAALRSTATTLPLRSYSQPASLQDSSILTWSDFFKLRKQQRRINVGSSLFTALLGCNVSWAYLSTMEIDPTQMLFGFDPLTVISAGIIASGALGYLLGPIVGSQVFKLSHNQQLAQFNNKNKEFLKHIINNRVDASSQSFSNPVPDYYGEKIGSLKEYKQWLRDCHAYAKKAKEFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MFTSAIRLSSQ ----CCCHHHHHHHH | 15.50 | 28889911 | |
| 9 | Phosphorylation | FTSAIRLSSQRLFAS CCHHHHHHHHCHHHC | 17.99 | 28889911 | |
| 141 | Acetylation | QLAQFNNKNKEFLKH HHHHHCCCCHHHHHH | 71.19 | 24489116 | |
| 147 | Acetylation | NKNKEFLKHIINNRV CCCHHHHHHHHHCCC | 37.77 | 24489116 | |
| 158 | Phosphorylation | NNRVDASSQSFSNPV HCCCCCCCCCCCCCC | 31.40 | 27214570 | |
| 172 | Acetylation | VPDYYGEKIGSLKEY CCCCCCCCCCCHHHH | 48.26 | 24489116 | |
| 177 | Acetylation | GEKIGSLKEYKQWLR CCCCCCHHHHHHHHH | 61.77 | 24489116 | |
| 177 | Succinylation | GEKIGSLKEYKQWLR CCCCCCHHHHHHHHH | 61.77 | 23954790 | |
| 180 | Acetylation | IGSLKEYKQWLRDCH CCCHHHHHHHHHHHH | 35.77 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAM17_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAM17_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAM17_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
