dbPTM

MET28_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MET28_YEAST
UniProt AC	P40573
Protein Name	Transcriptional activator of sulfur metabolism MET28
Gene Name	MET28
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	187
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Acts as an accessory factor in the activation of sulfur amino acids metabolism genes. Possesses no intrinsic transcription activation abilities. Binds to the MET16 promoter as a complex with MET4 and CBF1. Enhances the DNA-binding activity of CBF1..
Protein Sequence	MSAKQGWEKKSTNIDIASRKGMNVNNLSEHLQNLISSDSELGSRLLSLLLVSSGNAEELISMINNGQDVSQFKKLREPRKGKVAATTAVVVKEEEAPVSTSNELDKIKQERRRKNTEASQRFRIRKKQKNFENMNKLQNLNTQINKLRDRIEQLNKENEFWKAKLNDINEIKSLKLLNDIKRRNMGR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
11	Phosphorylation	KQGWEKKSTNIDIAS HCCCCCCCCCCCHHH	37.44	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MET28_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MET28_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MET28_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MET4_YEAST	MET4	physical	17157252
ATG17_YEAST	ATG17	physical	18719252
TF2B_YEAST	SUA7	physical	19602510
UBP8_YEAST	UBP8	genetic	20959818
CHD1_YEAST	CHD1	genetic	20959818
SET3_YEAST	SET3	genetic	20959818
MET31_YEAST	MET31	genetic	20959818
HOS2_YEAST	HOS2	genetic	20959818
UBP3_YEAST	UBP3	genetic	20959818
OCA4_YEAST	OCA4	genetic	21127252
UPC2_YEAST	UPC2	genetic	21127252
MET4_YEAST	MET4	physical	23661758
CHK1_YEAST	CHK1	genetic	27708008
PP2C1_YEAST	PTC1	genetic	27708008
AIM6_YEAST	AIM6	genetic	27708008
ARO1_YEAST	ARO1	genetic	27708008
MRX10_YEAST	YDR282C	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
RL21B_YEAST	RPL21B	genetic	27708008
ECM15_YEAST	ECM15	genetic	27708008
CCZ1_YEAST	CCZ1	genetic	27708008
SGF29_YEAST	SGF29	genetic	27708008
RV161_YEAST	RVS161	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
IMG2_YEAST	IMG2	genetic	27708008
PAT1_YEAST	PAT1	genetic	27708008
RL35A_YEAST	RPL35A	genetic	27708008
RL35B_YEAST	RPL35A	genetic	27708008
STB3_YEAST	STB3	genetic	27708008
UME6_YEAST	UME6	genetic	27708008
WWM1_YEAST	WWM1	genetic	27708008
RL22B_YEAST	RPL22B	genetic	27708008
GCN20_YEAST	GCN20	genetic	27708008
CSK2B_YEAST	CKB1	genetic	27708008
PALF_YEAST	RIM8	genetic	27708008
AAKG_YEAST	SNF4	genetic	27708008
HSV2_YEAST	HSV2	genetic	27708008
RS27B_YEAST	RPS27B	genetic	27708008
PIH1_YEAST	PIH1	genetic	27708008
MDV1_YEAST	MDV1	genetic	27708008
CBF1_YEAST	CBF1	genetic	27708008
CTK1_YEAST	CTK1	genetic	27708008
SRN2_YEAST	SRN2	genetic	27708008
CHS5_YEAST	CHS5	genetic	27708008
VAC14_YEAST	VAC14	genetic	27708008
SST2_YEAST	SST2	genetic	27708008
CSI1_YEAST	CSI1	genetic	27708008
HMI1_YEAST	HMI1	genetic	27708008
DGK1_YEAST	DGK1	genetic	27708008
YP260_YEAST	YPL260W	genetic	27708008
THP3_YEAST	THP3	genetic	27708008
BRR1_YEAST	BRR1	genetic	27708008
PPAL_YEAST	LTP1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MET28_YEAST

Related Literatures of Post-Translational Modification