AIM6_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AIM6_YEAST
• UniProt AC: Q07716
• Protein Name: Altered inheritance of mitochondria protein 6
• Gene Name: AIM6
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 390
• Protein Sequence: MLGLKGCLTILIGYVIAVCALFSSRGRNPSLTDWEKLKDQKISNIDNFGLTGQHLLEFFQENLPFLSFSEEKYRHKHVSLYYDVFKEYILRRASSKKCLPVDSAIAKLNKDVNPMPVHSHNDYWRKLPLFEGLAYGASSTEADVWNIDEKILAVGHNEAYLDPVELTLDKLYTGPLLEILDEVNCQDSDADRKNGVFFNSPETSLFFYIDFKSDDNELTYKLLMEQYFKSLIDSGYLTYYDMKKDEIIWRPVTVILTGNYPTSLDILDNGNDNGYFESSQRFAFLDAPLLSLEPKYSKLSVAATVSFSQLMKHCGSDHWKVSLRGRMDSNEISCAKSIIDGAHALKLKTRIWGAPTWPANLVETISRQIIHDLGSDLLNLDNLFMASSLI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
300	Phosphorylation	EPKYSKLSVAATVSF CCCCCCCHHHHEEEH	17.28	19779198
308	Phosphorylation	VAATVSFSQLMKHCG HHHEEEHHHHHHHHC	18.20	19779198
346	Acetylation	IDGAHALKLKTRIWG HHHHHHHHCCEEECC	49.04	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AIM6_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AIM6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AIM6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AP3M_YEAST	APM3	genetic	27708008
BSD2_YEAST	BSD2	genetic	27708008
PIR5_YEAST	YJL160C	genetic	27708008
RNH2A_YEAST	RNH201	genetic	27708008
MTHR1_YEAST	MET12	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.