| UniProt ID | PP2C1_YEAST | |
|---|---|---|
| UniProt AC | P35182 | |
| Protein Name | Protein phosphatase 2C homolog 1 | |
| Gene Name | PTC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 281 | |
| Subcellular Localization | ||
| Protein Description | It has a serine and a weak tyrosine phosphatase activity with ratios of serine to tyrosine phosphatase activity as high as 200:1. It is essential for growth or germination at 37 degrees Celsius. May have a role in the heat shock response. Involved in tRNA splicing and cell separation.. | |
| Protein Sequence | MSNHSEILERPETPYDITYRVGVAENKNSKFRRTMEDVHTYVKNFASRLDWGYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITSEDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVVFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSNHSEILE ------CCCHHHHHC | 43.16 | 22369663 | |
| 5 | Phosphorylation | ---MSNHSEILERPE ---CCCHHHHHCCCC | 30.49 | 22369663 | |
| 13 | Phosphorylation | EILERPETPYDITYR HHHCCCCCCCCCEEE | 29.81 | 22369663 | |
| 15 | Phosphorylation | LERPETPYDITYRVG HCCCCCCCCCEEEEE | 27.65 | 22369663 | |
| 18 | Phosphorylation | PETPYDITYRVGVAE CCCCCCCEEEEEECC | 11.46 | 22369663 | |
| 19 | Phosphorylation | ETPYDITYRVGVAEN CCCCCCEEEEEECCC | 12.02 | 22369663 | |
| 128 | Phosphorylation | LRWELPDSVSDDSMD EEEECCCCCCCCCCC | 22.91 | 22369663 | |
| 130 | Phosphorylation | WELPDSVSDDSMDLA EECCCCCCCCCCCHH | 39.38 | 22369663 | |
| 133 | Phosphorylation | PDSVSDDSMDLAQHQ CCCCCCCCCCHHHHH | 21.13 | 22369663 | |
| 144 | Phosphorylation | AQHQRKLYTANVGDS HHHHHHHHHCCCCCC | 13.57 | 24930733 | |
| 151 | Phosphorylation | YTANVGDSRIVLFRN HHCCCCCCEEEEEEC | 20.27 | 24930733 | |
| 169 | Acetylation | IRLTYDHKASDTLEM EEEEECCCCCCCEEE | 46.84 | 24489116 | |
| 188 | Ubiquitination | QAGGLIMKSRVNGML HHCCEEEECCCCCEE | 28.28 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2C1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2C1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2C1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
