| UniProt ID | GMT1_YEAST | |
|---|---|---|
| UniProt AC | P40107 | |
| Protein Name | GDP-mannose transporter 1 | |
| Gene Name | VRG4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 337 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. Cytoplasmic vesicle membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. Recycles between the Golgi apparatus and the endoplasmic reticulum. |
|
| Protein Description | Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen. Defective copy causes severe glycosylation defect and abnormal retention of soluble endoplasmic reticulum proteins. Involved in vanadate sensitivity.. | |
| Protein Sequence | MSELKTGHAGHNPWASVANSGPISILSYCGSSILMTVTNKFVVNLKDFNMNFVMLFVQSLVCTITLIILRILGYAKFRSLNKTDAKNWFPISFLLVLMIYTSSKALQYLAVPIYTIFKNLTIILIAYGEVLFFGGSVTSMELSSFLLMVLSSVVATWGDQQAVAAKAASLAEGAAGAVASFNPGYFWMFTNCITSALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWSSVNLTNNFSNDSLTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNFLSILSIFIGFLSGIIYAVAKQKKQQAQPLRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 119 | N-linked_Glycosylation | PIYTIFKNLTIILIA HHHHHHHCCCEEEEE | 31.50 | - | |
| 242 | N-linked_Glycosylation | VEDWSSVNLTNNFSN CCCCCCCCCCCCCCC | 42.99 | - | |
| 246 | N-linked_Glycosylation | SSVNLTNNFSNDSLT CCCCCCCCCCCCHHH | 36.17 | - | |
| 249 | N-linked_Glycosylation | NLTNNFSNDSLTAMI CCCCCCCCCHHHHHH | 38.46 | - | |
| 277 | Phosphorylation | GWCVRVTSSTTYSMV CEEEEEEECCCHHHH | 23.88 | 27017623 | |
| 281 | Phosphorylation | RVTSSTTYSMVGALN EEEECCCHHHHHHHH | 8.54 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GMT1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GMT1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GMT1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
