| UniProt ID | DCW1_YEAST | |
|---|---|---|
| UniProt AC | P36091 | |
| Protein Name | Mannan endo-1,6-alpha-mannosidase DCW1 | |
| Gene Name | DCW1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 449 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . GPI-anchored plasma membrane protein (GPI-PMP). |
|
| Protein Description | Required for normal synthesis of the cell wall.. | |
| Protein Sequence | MLVNKVIGLLGVLFATRFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLLLAGSAYLYNFTGSDLWHTRTKEFLNASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYFARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQMSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLAPLNITKGSKAGAGIITAVIGISIVACALWLVF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | N-linked_Glycosylation | DNYESLQNATSLIAY CCHHHHHHHHHHHHH | 50.94 | - | |
| 84 | N-linked_Glycosylation | DYWFFMDNDTYNDEI EEEEEECCCCCCHHH | 31.56 | - | |
| 109 | N-linked_Glycosylation | DNDYIPLNQSTTEGN CCCEECCCCCCCCCC | 28.53 | - | |
| 133 | N-linked_Glycosylation | AMTAAERNFTNPPEN HHHHHHHCCCCCCCC | 39.33 | - | |
| 203 | N-linked_Glycosylation | RLARYTGNQTYVDWA HHHHHHCCCCCCHHH | 24.18 | - | |
| 224 | Phosphorylation | MVGVNLISNGTYKYV HHCCEEEECCEEEEE | 32.16 | 28889911 | |
| 225 | N-linked_Glycosylation | VGVNLISNGTYKYVY HCCEEEECCEEEEEE | 39.57 | - | |
| 228 | Phosphorylation | NLISNGTYKYVYDGV EEEECCEEEEEECCE | 11.17 | 29650682 | |
| 240 | N-linked_Glycosylation | DGVSIDDNCTKVTSY CCEEECCCCCEEEEE | 31.45 | - | |
| 265 | N-linked_Glycosylation | AGSAYLYNFTGSDLW ECEEEEEECCCCCCC | 25.96 | - | |
| 281 | N-linked_Glycosylation | TRTKEFLNASQVFFH CCCHHHHCHHHEEEC | 42.75 | - | |
| 337 | N-linked_Glycosylation | NQIMSWLNTSAIAAA HHHHHHHCHHHHHHH | 26.23 | - | |
| 362 | N-linked_Glycosylation | TCGLNWFNGTWDGMY CCCCCCCCCCCCCCC | 38.30 | - | |
| 400 | Phosphorylation | YTAENGGSSVGDGAA CCCCCCCCCCCCCCC | 24.21 | 28889911 | |
| 401 | Phosphorylation | TAENGGSSVGDGAAG CCCCCCCCCCCCCCC | 33.13 | 28889911 | |
| 420 | N-linked_Glycosylation | PTNLAPLNITKGSKA CCCCCCCCCCCCCCC | 38.53 | - | |
| 428 | GPI-anchor | ITKGSKAGAGIITAV CCCCCCCCCHHHHHH | 28.24 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCW1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCW1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCW1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DFG5_YEAST | DFG5 | genetic | 12421307 | |
| OSTD_YEAST | SWP1 | physical | 18467557 | |
| SSB1_YEAST | SSB1 | physical | 22940862 | |
| HSP71_YEAST | SSA1 | physical | 22940862 | |
| DFG5_YEAST | DFG5 | genetic | 23891562 | |
| SLG1_YEAST | SLG1 | genetic | 23891562 | |
| TLG2_YEAST | TLG2 | genetic | 23891562 | |
| CCW12_YEAST | CCW12 | genetic | 23891562 | |
| MSMO_YEAST | ERG25 | genetic | 23891562 | |
| ELO3_YEAST | ELO3 | genetic | 23891562 | |
| ETR1_YEAST | ETR1 | genetic | 27708008 | |
| PUT4_YEAST | PUT4 | genetic | 27708008 | |
| FLC2_YEAST | FLC2 | genetic | 27708008 | |
| YJ66_YEAST | YJR096W | genetic | 27708008 | |
| RT109_YEAST | RTT109 | genetic | 27708008 | |
| DFG5_YEAST | DFG5 | genetic | 27708008 | |
| STI1_YEAST | STI1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A proteomics approach to understanding protein ubiquitination."; Peng J., Schwartz D., Elias J.E., Thoreen C.C., Cheng D.,Marsischky G., Roelofs J., Finley D., Gygi S.P.; Nat. Biotechnol. 21:921-926(2003). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-400 AND SER-401, ANDMASS SPECTROMETRY. | |