| UniProt ID | RGI2_YEAST | |
|---|---|---|
| UniProt AC | P40188 | |
| Protein Name | Respiratory growth induced protein 2 | |
| Gene Name | RGI2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 164 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Involved in the control of energetic metabolism and significantly contribute to cell fitness, especially under respiratory growth conditions.. | |
| Protein Sequence | MTKKDKKAKGPKMSTITTKSGESLKVFEDLHDFETYLKGETEDQEFDHVHCQLKYYPPFVLHDAHDDPEKIKETANSHSKKFVRHLHQHVEKHLLKDIKTAINKPELKFHDKKKQESFDRIVWNYGEETELNAKKFKVSVEVVCKHDGAMVDVDYKTEPLQPLI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RGI2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGI2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGI2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YCY0_YEAST | YCR090C | genetic | 27708008 | |
| NCBP2_YEAST | CBC2 | genetic | 27708008 | |
| CDC4_YEAST | CDC4 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| GAA1_YEAST | GAA1 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| MAP2_YEAST | MAP2 | genetic | 27708008 | |
| YPQ3_YEAST | RTC2 | genetic | 27708008 | |
| NRG1_YEAST | NRG1 | genetic | 27708008 | |
| IES5_YEAST | IES5 | genetic | 27708008 | |
| SWP82_YEAST | SWP82 | genetic | 27708008 | |
| KA122_YEAST | KAP122 | genetic | 27708008 | |
| MST27_YEAST | MST27 | genetic | 27708008 | |
| MED5_YEAST | NUT1 | genetic | 27708008 | |
| ATG1_YEAST | ATG1 | genetic | 27708008 | |
| CGS6_YEAST | CLB6 | genetic | 27708008 | |
| SODM_YEAST | SOD2 | genetic | 27708008 | |
| ACF4_YEAST | ACF4 | genetic | 27708008 | |
| PUB1_YEAST | PUB1 | genetic | 27708008 | |
| FAR11_YEAST | FAR11 | genetic | 27708008 | |
| NGL1_YEAST | NGL1 | genetic | 27708008 | |
| HPF1_YEAST | HPF1 | genetic | 27708008 | |
| LIPA_YEAST | LIP5 | genetic | 27708008 | |
| MET31_YEAST | MET31 | genetic | 27708008 | |
| YP260_YEAST | YPL260W | genetic | 27708008 | |
| MDL2_YEAST | MDL2 | genetic | 27708008 | |
| MRL1_YEAST | MRL1 | genetic | 27708008 | |
| MDM36_YEAST | MDM36 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-74, AND MASSSPECTROMETRY. | |