UniProt ID | NGL1_YEAST | |
---|---|---|
UniProt AC | Q08213 | |
Protein Name | RNA exonuclease NGL1 | |
Gene Name | NGL1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 363 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MFTRRFIPVVQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNTHLYWKYDEVKLTQCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNSTRDSLVVNFLQGQIVSHGDLNLINPMRPYLDRCVYDDIPKDYFVHTCYSGKLKGIFDYVWYHDSDFLLTKILTGNEVSDELLASNQLGLPNENHPSDHIPLLTEFKIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Acetylation | YRHRLLEKELLNTFK HHHHHHHHHHHHHHH | 54.34 | 24489116 | |
88 | Phosphorylation | TARDYEDYWHDSIGV HHCCHHHHCCCCEEE | 7.84 | 27017623 | |
92 | Phosphorylation | YEDYWHDSIGVDVNY HHHHCCCCEEECCCC | 14.35 | 27017623 | |
99 | Phosphorylation | SIGVDVNYGSKFISK CEEECCCCCCCCCCC | 23.71 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NGL1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NGL1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NGL1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...