| UniProt ID | CTH2_YEAST | |
|---|---|---|
| UniProt AC | P47977 | |
| Protein Name | mRNA decay factor CTH2 | |
| Gene Name | TIS11 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 285 | |
| Subcellular Localization | Nucleus . Cytoplasm, P-body . | |
| Protein Description | Binds to specific AU-rich elements (ARE) in the 3'-untranslated region of target mRNAs and promotes their degradation. In response to iron deficiency, promotes the decay of many mRNAs encoding proteins involved in iron-dependent pathways. Recruits the DHH1 helicase to the SDH4 mRNA and promotes SDH4 mRNA decay. Also destabilizes target mRNA by modulating 3'-end processing, creating extended transcripts that are prone for degradation.. | |
| Protein Sequence | MWAQLSYTRPESQKTDLTSLFSTDQEQNPLNDYQYQINIRELEEYYNKTILNEDNIQETSSEISSAVSFSPPKNTNAIQPGLLYDPQLMNPFLPSAHLNSTAPTTFKKKLEVQINPDYVPKSSQLPLTSQNLQQLSQQKPKNDASFSSEKESSAQPKVKSQVQETPKQLYKTELCESFTLKGSCPYGSKCQFAHGLGELKVKKSCKNFRTKPCVNWEKLGYCPYGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKKNLNVKVKALQRMTW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 107 | Ubiquitination | STAPTTFKKKLEVQI CCCCCCHHHEEEEEE | 47.08 | 17644757 | |
| 108 | Ubiquitination | TAPTTFKKKLEVQIN CCCCCHHHEEEEEEC | 59.40 | 17644757 | |
| 109 | Ubiquitination | APTTFKKKLEVQINP CCCCHHHEEEEEECC | 50.93 | 17644757 | |
| 121 | Ubiquitination | INPDYVPKSSQLPLT ECCCCCCCHHHCCCC | 53.33 | 17644757 | |
| 139 | Ubiquitination | LQQLSQQKPKNDASF HHHHHCCCCCCCCCC | 50.77 | 17644757 | |
| 141 | Ubiquitination | QLSQQKPKNDASFSS HHHCCCCCCCCCCCC | 74.60 | 17644757 | |
| 150 | Ubiquitination | DASFSSEKESSAQPK CCCCCCHHHHCCCHH | 65.92 | 17644757 | |
| 157 | Ubiquitination | KESSAQPKVKSQVQE HHHCCCHHHHHHHHH | 50.65 | 17644757 | |
| 160 | Phosphorylation | SAQPKVKSQVQETPK CCCHHHHHHHHHCHH | 38.27 | 25704821 | |
| 189 | Ubiquitination | GSCPYGSKCQFAHGL CCCCCCCCCHHHCCC | 27.91 | 17644757 | |
| 200 | Ubiquitination | AHGLGELKVKKSCKN HCCCCEEEECHHCCC | 47.94 | 17644757 | |
| 218 | Ubiquitination | KPCVNWEKLGYCPYG CCCCCHHHCCCCCCC | 38.54 | 17644757 | |
| 231 | Ubiquitination | YGRRCCFKHGDDNDI CCCCEEEECCCCCCE | 32.53 | 17644757 | |
| 243 | Ubiquitination | NDIAVYVKAGTYCNV CCEEEEEEECCEECC | 24.34 | 17644757 | |
| 284 | Phosphorylation | VKALQRMTW------ HEEHHHCCC------ | 30.16 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CTH2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CTH2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CTH2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
