| UniProt ID | IES5_YEAST | |
|---|---|---|
| UniProt AC | P40060 | |
| Protein Name | Ino eighty subunit 5 | |
| Gene Name | IES5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 125 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MPSKDPESVIDKEIRKISARNDELIKQDGTLKREYTTLLRKVSSVITVLNSIDDADTGSAETELPRLISQATVEKVPELKWYNDQISLITEKLEDDEDIEVPEELMDAYTLYKETPLLYNDTHTP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MPSKDPESVIDKEIR CCCCCHHHHHHHHHH | 29.75 | 23749301 | |
| 43 | Phosphorylation | TTLLRKVSSVITVLN HHHHHHHHHHHHHHH | 23.17 | 17563356 | |
| 44 | Phosphorylation | TLLRKVSSVITVLNS HHHHHHHHHHHHHHC | 22.11 | 28889911 | |
| 69 | Phosphorylation | TELPRLISQATVEKV HHHHHHHCHHHHHCC | 20.53 | 23749301 | |
| 72 | Phosphorylation | PRLISQATVEKVPEL HHHHCHHHHHCCCCC | 22.89 | 23749301 | |
| 87 | Phosphorylation | KWYNDQISLITEKLE CCCCHHHHHHHHHCC | 14.21 | 27017623 | |
| 115 | Phosphorylation | AYTLYKETPLLYNDT HHHHHHHCCCCCCCC | 18.32 | 22369663 | |
| 119 | Phosphorylation | YKETPLLYNDTHTP- HHHCCCCCCCCCCC- | 20.76 | 29136822 | |
| 122 | Phosphorylation | TPLLYNDTHTP---- CCCCCCCCCCC---- | 24.82 | 22369663 | |
| 124 | Phosphorylation | LLYNDTHTP------ CCCCCCCCC------ | 32.55 | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IES5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IES5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IES5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-44 AND THR-124, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-43, AND MASSSPECTROMETRY. | |
