| UniProt ID | SWD3_YEAST | |
|---|---|---|
| UniProt AC | P38123 | |
| Protein Name | COMPASS component SWD3 | |
| Gene Name | SWD3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 315 | |
| Subcellular Localization | Nucleus . Chromosome, telomere . | |
| Protein Description | The COMPASS (Set1C) complex specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.. | |
| Protein Sequence | MFQFVTPVGTQNGLKATCAKISPDGQFLAITQGLNILIYDINRRTVSQTLVTSHARPFSELCWSPDGQCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIHCFGNIMCSLALNGDCCLWRWV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 151 | Phosphorylation | VDVPMNDSSILSSGS EECCCCCCHHHCCCC | 17.80 | 29136822 | |
| 152 | Phosphorylation | DVPMNDSSILSSGSY ECCCCCCHHHCCCCC | 30.34 | 29136822 | |
| 155 | Phosphorylation | MNDSSILSSGSYDGL CCCCHHHCCCCCCCE | 30.86 | 29136822 | |
| 156 | Phosphorylation | NDSSILSSGSYDGLI CCCHHHCCCCCCCEE | 28.45 | 29136822 | |
| 158 | Phosphorylation | SSILSSGSYDGLIRI CHHHCCCCCCCEEEE | 23.23 | 29136822 | |
| 159 | Phosphorylation | SILSSGSYDGLIRIF HHHCCCCCCCEEEEE | 19.97 | 29136822 | |
| 193 | Phosphorylation | ENGVVPISQVKFSEN HCCEEEHEEEECCCC | 23.89 | 26447709 | |
| 198 | Phosphorylation | PISQVKFSENARYLL EHEEEECCCCCEEEE | 24.99 | 26447709 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SWD3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWD3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWD3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
