| UniProt ID | YHI9_YEAST | |
|---|---|---|
| UniProt AC | P38765 | |
| Protein Name | Uncharacterized isomerase YHI9 | |
| Gene Name | YHI9 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 294 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTLMVPFKQVDVFTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITINEGLISFKAPMADYESISSEMIADYEKAIGLKFIKPPALLHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQEVYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHI9_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHI9_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHI9_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IDS2_YEAST | IDS2 | physical | 16429126 | |
| IME2_YEAST | IME2 | genetic | 27708008 | |
| PUR6_YEAST | ADE2 | genetic | 27708008 | |
| LCB4_YEAST | LCB4 | genetic | 27708008 | |
| RMI1_YEAST | RMI1 | genetic | 27708008 | |
| SGF29_YEAST | SGF29 | genetic | 27708008 | |
| IES1_YEAST | IES1 | genetic | 27708008 | |
| MAL12_YEAST | MAL12 | genetic | 27708008 | |
| CTK3_YEAST | CTK3 | genetic | 27708008 | |
| GCSP_YEAST | GCV2 | genetic | 27708008 | |
| YN9A_YEAST | YNR071C | genetic | 27708008 | |
| ESC8_YEAST | ESC8 | genetic | 27708008 | |
| CRC1_YEAST | CRC1 | genetic | 27708008 | |
| AAD16_YEAST | YPL088W | genetic | 27708008 | |
| MDM36_YEAST | MDM36 | genetic | 27708008 | |
| ATG13_YEAST | ATG13 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...