UniProt ID | YHI9_YEAST | |
---|---|---|
UniProt AC | P38765 | |
Protein Name | Uncharacterized isomerase YHI9 | |
Gene Name | YHI9 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 294 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTLMVPFKQVDVFTEKPFMGNPVAVINFLEIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSELPFAGHPTIGSCKAFLEFTKNTTATSLVQECKIGAVPITINEGLISFKAPMADYESISSEMIADYEKAIGLKFIKPPALLHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQNDHVGIILAGPKKEAAIKNSYEMRAFAPVINVYEDPVCGSGSVALARYLQEVYKFEKTTDITISEGGRLKRNGLMLASIKKEADNSTSYYIAGHATTVIDGKIKV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHI9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHI9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHI9_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IDS2_YEAST | IDS2 | physical | 16429126 | |
IME2_YEAST | IME2 | genetic | 27708008 | |
PUR6_YEAST | ADE2 | genetic | 27708008 | |
LCB4_YEAST | LCB4 | genetic | 27708008 | |
RMI1_YEAST | RMI1 | genetic | 27708008 | |
SGF29_YEAST | SGF29 | genetic | 27708008 | |
IES1_YEAST | IES1 | genetic | 27708008 | |
MAL12_YEAST | MAL12 | genetic | 27708008 | |
CTK3_YEAST | CTK3 | genetic | 27708008 | |
GCSP_YEAST | GCV2 | genetic | 27708008 | |
YN9A_YEAST | YNR071C | genetic | 27708008 | |
ESC8_YEAST | ESC8 | genetic | 27708008 | |
CRC1_YEAST | CRC1 | genetic | 27708008 | |
AAD16_YEAST | YPL088W | genetic | 27708008 | |
MDM36_YEAST | MDM36 | genetic | 27708008 | |
ATG13_YEAST | ATG13 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...