| UniProt ID | SWD2_YEAST | |
|---|---|---|
| UniProt AC | P36104 | |
| Protein Name | COMPASS component SWD2 | |
| Gene Name | SWD2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 329 | |
| Subcellular Localization | Nucleus . Chromosome, telomere . | |
| Protein Description | The COMPASS (Set1C) complex specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently plays a role in telomere length maintenance and transcription elongation regulation.; Involved in mediating RNA polymerase II termination. Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation.. | |
| Protein Sequence | MTTVSINKPNLLKFKHVKSFQPQEKDCGPVTSLNFDDNGQFLLTSSSNDTMQLYSATNCKFLDTIASKKYGCHSAIFTHAQNECIYSSTMKNFDIKYLNLETNQYLRYFSGHGALVNDLKMNPVNDTFLSSSYDESVRLWDLKISKPQVIIPSLVPNCIAYDPSGLVFALGNPENFEIGLYNLKKIQEGPFLIIKINDATFSQWNKLEFSNNGKYLLVGSSIGKHLIFDAFTGQQLFELIGTRAFPMREFLDSGSACFTPDGEFVLGTDYDGRIAIWNHSDSISNKVLRPQGFIPCVSHETCPRSIAFNPKYSMFVTADETVDFYVYDE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTTVSINKP ------CCEECCCCC | 35.59 | 21126336 | |
| 3 | Phosphorylation | -----MTTVSINKPN -----CCEECCCCCC | 15.80 | 28152593 | |
| 5 | Phosphorylation | ---MTTVSINKPNLL ---CCEECCCCCCEE | 20.53 | 24961812 | |
| 70 | Phosphorylation | DTIASKKYGCHSAIF HHHHHHCCCCCCHHH | 28.81 | 19823750 | |
| 74 | Phosphorylation | SKKYGCHSAIFTHAQ HHCCCCCCHHHHHCC | 27.43 | 19823750 | |
| 78 | Phosphorylation | GCHSAIFTHAQNECI CCCCHHHHHCCCCEE | 15.36 | 19823750 | |
| 86 | Phosphorylation | HAQNECIYSSTMKNF HCCCCEEEECCCCCC | 14.29 | 19823750 | |
| 87 | Phosphorylation | AQNECIYSSTMKNFD CCCCEEEECCCCCCE | 10.22 | 19823750 | |
| 88 | Phosphorylation | QNECIYSSTMKNFDI CCCEEEECCCCCCEE | 18.62 | 19823750 | |
| 89 | Phosphorylation | NECIYSSTMKNFDIK CCEEEECCCCCCEEE | 26.65 | 19823750 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SWD2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SWD2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
