IRC18_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IRC18_YEAST
• UniProt AC: P47056
• Protein Name: Outer spore wall protein 6 {ECO:0000303|PubMed:23966878}
• Gene Name: IRC18 {ECO:0000303|PubMed:18085829}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 224
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Involved in spore wall assembly..
• Protein Sequence: MKVQMIERIFLIQLCLLTVVLASSRAVVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISGIERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNRAVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISRVVAATTIEAGLAQGVVDLCITVTTSLCLVSASIGGVGFLIWLTIIYQALT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
74	N-linked_Glycosylation	EVKDMYGNHSFILKG HHHHHHCCCHHHHHH	15.33	-
104	N-linked_Glycosylation	IQMETVGNNTFETET HHHHCCCCCCEECCC	39.78	-
106	Phosphorylation	METVGNNTFETETGK HHCCCCCCEECCCCC	27.18	27017623
159	Phosphorylation	AKKGGELTEEQKKKK HHCCCCCCHHHHHHH	32.92	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IRC18_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IRC18_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IRC18_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LRP1_YEAST	LRP1	genetic	27708008
YHY2_YEAST	YHR182W	genetic	27708008
MNE1_YEAST	MNE1	genetic	27708008
SUR1_YEAST	SUR1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.