| UniProt ID | MNN10_YEAST | |
|---|---|---|
| UniProt AC | P50108 | |
| Protein Name | Probable alpha-1,6-mannosyltransferase MNN10 | |
| Gene Name | MNN10 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 393 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein. Golgi apparatus, cis-Golgi network membrane Single-pass type II membrane protein. |
|
| Protein Description | Required for polarized growth and efficient budding.; The M-Pol II complex possesses alpha-1,6-mannosyltransferase activity and is probably involved in the elongation of the mannan backbone of N-linked glycans on cell wall and periplasmic proteins.. | |
| Protein Sequence | MSSVPYNSQLPISNHLEYDEDEKKSRGSKLGLKYKMIYWRKTLCSSLARWRKLILLISLALFLFIWISDSTISRNPSTTSFQGQNSNDNKLSNTGSSINSKRYVPPYSKRSRWSFWNQDPRIVIILAANEGGGVLRWKNEQEWAIEGISIENKKAYAKRHGYALTIKDLTTSKRYSHEYREGWQKVDILRQTFREFPNAEWFWWLDLDTMIMEPSKSLEEHIFDRLETLADRELKSFNPLNLRDDIPYVDYSEEMEFLITQDCGGFNLGSFLIKNSEWSKLLLDMWWDPVLYEQKHMVWEHREQDALEALYENEPWIRSRIGFLPLRTINAFPPGACSEYSGDSRYFYSEKDHDFVVNMAGCNFGRDCWGEMQYYTTLMEKLNRKWYTRFFFP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MSSVPYNSQLPIS --CCCCCCCCCCCCC | 25.87 | 28132839 | |
| 18 | Phosphorylation | PISNHLEYDEDEKKS CCCCCCCCCCCHHHH | 30.87 | 28132839 | |
| 23 | Acetylation | LEYDEDEKKSRGSKL CCCCCCHHHHHHCHH | 69.26 | 24489116 | |
| 101 | Ubiquitination | TGSSINSKRYVPPYS CCCCCCCCCCCCCCC | 43.17 | 23749301 | |
| 375 | Phosphorylation | CWGEMQYYTTLMEKL CHHHHHHHHHHHHHH | 4.02 | 27017623 | |
| 376 | Phosphorylation | WGEMQYYTTLMEKLN HHHHHHHHHHHHHHC | 14.44 | 27017623 | |
| 377 | Phosphorylation | GEMQYYTTLMEKLNR HHHHHHHHHHHHHCH | 14.16 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MNN10_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MNN10_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MNN10_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
