UniProt ID | YP063_YEAST | |
---|---|---|
UniProt AC | Q12160 | |
Protein Name | Uncharacterized protein YPR063C | |
Gene Name | YPR063C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 140 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSVHYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSKGNTETTIETTTEVETETAKQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTLNNVARP ------CCCCCCCCC | 37.89 | 30377154 | |
15 | Phosphorylation | RPDLCVSYKKIAPPK CCCCEEECCCCCCCC | 8.90 | 30377154 | |
36 | N-linked_Glycosylation | PSISGVVNQSMPMAA CCHHHCCCCCCCHHH | 26.29 | - | |
78 | Ubiquitination | IVAYKENKAPSPMDQ EEEECCCCCCCCCCC | 63.87 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP063_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP063_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP063_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHO2_YEAST | CHO2 | genetic | 16269340 | |
PLMT_YEAST | OPI3 | genetic | 16269340 | |
YOP1_YEAST | YOP1 | genetic | 16269340 | |
PMA1_YEAST | PMA1 | genetic | 16269340 | |
ICS2_YEAST | ICS2 | genetic | 27708008 | |
SHG1_YEAST | SHG1 | genetic | 27708008 | |
PET8_YEAST | PET8 | genetic | 27708008 | |
PMS1_YEAST | PMS1 | genetic | 27708008 | |
ERF3_YEAST | SUP35 | genetic | 27708008 | |
CDC1_YEAST | CDC1 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
CAK1_YEAST | CAK1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
SWD2_YEAST | SWD2 | genetic | 27708008 | |
PRS7_YEAST | RPT1 | genetic | 27708008 | |
UTP15_YEAST | UTP15 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
DCP2_YEAST | DCP2 | genetic | 27708008 | |
DIM1_YEAST | DIM1 | genetic | 27708008 | |
PP2C3_YEAST | PTC3 | genetic | 27708008 | |
STE50_YEAST | STE50 | genetic | 27708008 | |
RPN4_YEAST | RPN4 | genetic | 27708008 | |
RL13A_YEAST | RPL13A | genetic | 27708008 | |
YGZ2_YEAST | YGL242C | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
OPI1_YEAST | OPI1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...