| UniProt ID | YOP1_YEAST | |
|---|---|---|
| UniProt AC | Q12402 | |
| Protein Name | Protein YOP1 | |
| Gene Name | YOP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 180 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. |
|
| Protein Description | Involved in membrane/vesicle trafficking.. | |
| Protein Sequence | MSEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEILSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLKTVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSEYASSIH ------CCHHHHHHH | 39.04 | 22814378 | |
| 2 | Phosphorylation | ------MSEYASSIH ------CCHHHHHHH | 39.04 | 29136822 | |
| 4 | Phosphorylation | ----MSEYASSIHSQ ----CCHHHHHHHHH | 12.41 | 29136822 | |
| 6 | Phosphorylation | --MSEYASSIHSQMK --CCHHHHHHHHHHH | 28.99 | 24909858 | |
| 7 | Phosphorylation | -MSEYASSIHSQMKQ -CCHHHHHHHHHHHH | 19.02 | 24909858 | |
| 10 | Phosphorylation | EYASSIHSQMKQFDT HHHHHHHHHHHHHCC | 30.24 | 22369663 | |
| 13 | Ubiquitination | SSIHSQMKQFDTKYS HHHHHHHHHHCCCCC | 39.93 | 24961812 | |
| 13 | Acetylation | SSIHSQMKQFDTKYS HHHHHHHHHHCCCCC | 39.93 | 24489116 | |
| 17 | Phosphorylation | SQMKQFDTKYSGNRI HHHHHHCCCCCHHHH | 32.92 | 28889911 | |
| 18 | Acetylation | QMKQFDTKYSGNRIL HHHHHCCCCCHHHHH | 38.98 | 22865919 | |
| 142 | Acetylation | GARMIYQKIVAPLTD CHHHHHHHHHHHCCC | 23.37 | 24489116 | |
| 158 | Acetylation | YILRDVSKTEKDEIR HHHHCCCCCCHHHHH | 61.63 | 24489116 | |
| 161 | Acetylation | RDVSKTEKDEIRASV HCCCCCCHHHHHHHH | 66.93 | 24489116 | |
| 161 | Succinylation | RDVSKTEKDEIRASV HCCCCCCHHHHHHHH | 66.93 | 23954790 | |
| 167 | Phosphorylation | EKDEIRASVNEASKA CHHHHHHHHHHHHHH | 18.67 | 28889911 | |
| 172 | Phosphorylation | RASVNEASKATGASV HHHHHHHHHHHCCCC | 19.35 | 23749301 | |
| 173 | Ubiquitination | ASVNEASKATGASVH HHHHHHHHHHCCCCC | 57.95 | 23749301 | |
| 175 | Phosphorylation | VNEASKATGASVH-- HHHHHHHHCCCCC-- | 36.70 | 23749301 | |
| 178 | Phosphorylation | ASKATGASVH----- HHHHHCCCCC----- | 23.28 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YOP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YOP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YOP1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
