| UniProt ID | POM34_YEAST | |
|---|---|---|
| UniProt AC | Q12445 | |
| Protein Name | Nucleoporin POM34 | |
| Gene Name | POM34 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 299 | |
| Subcellular Localization |
Nucleus, nuclear pore complex. Nucleus membrane Multi-pass membrane protein. Central core structure of the nuclear pore complex. |
|
| Protein Description | Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors.. | |
| Protein Sequence | MKIQAGQLGLDDNDVPGPLPDTDSKPSSQSQNDTPMFKLGNFESPVLKELSRRTVNKEMETQRIMTNVIAFAFWNLLVKFIKFFWNNTHVGRQFCNRLSRIHLYMLTFHTLKKANIIYHTTFSWLNAELLDYLFHLLISLNILFSLWKLLSTVKVSDLNLTDRQKKLLGVDMQSSVDTGLQPQHPHYVSTSKISQMAQNKTHIPQTNLKNHPAYLFKGLETPLKARQREMAEEQTKLQSQSLHTKNVFGTLQRHSGISSTLVSANNDNNSPHTPVTRKGYIPSSKYAYMMNSQSPRGKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | GPLPDTDSKPSSQSQ CCCCCCCCCCCCCCC | 48.86 | 27214570 | |
| 28 | Phosphorylation | DTDSKPSSQSQNDTP CCCCCCCCCCCCCCC | 42.24 | 27214570 | |
| 221 | Phosphorylation | YLFKGLETPLKARQR HHHCCCCCCHHHHHH | 38.68 | 23749301 | |
| 241 | Phosphorylation | QTKLQSQSLHTKNVF HHHHHHHHHHHHHHH | 27.62 | 23749301 | |
| 255 | Phosphorylation | FGTLQRHSGISSTLV HHHHHHCCCCCCEEE | 39.76 | 30377154 | |
| 259 | Phosphorylation | QRHSGISSTLVSANN HHCCCCCCEEEECCC | 24.68 | 24961812 | |
| 260 | Phosphorylation | RHSGISSTLVSANND HCCCCCCEEEECCCC | 25.12 | 24961812 | |
| 263 | Phosphorylation | GISSTLVSANNDNNS CCCCEEEECCCCCCC | 28.52 | 19795423 | |
| 270 | Phosphorylation | SANNDNNSPHTPVTR ECCCCCCCCCCCCCC | 25.06 | 21440633 | |
| 273 | Phosphorylation | NDNNSPHTPVTRKGY CCCCCCCCCCCCCCC | 23.88 | 17330950 | |
| 276 | Phosphorylation | NSPHTPVTRKGYIPS CCCCCCCCCCCCCCH | 28.06 | 19795423 | |
| 292 | Phosphorylation | KYAYMMNSQSPRGKI HHHHHCCCCCCCCCC | 17.71 | 22369663 | |
| 294 | Phosphorylation | AYMMNSQSPRGKI-- HHHCCCCCCCCCC-- | 19.18 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POM34_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POM34_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POM34_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-294, AND MASSSPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-294, AND MASSSPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-294, AND MASSSPECTROMETRY. | |
| "Phosphoproteome analysis by mass spectrometry and its application toSaccharomyces cerevisiae."; Ficarro S.B., McCleland M.L., Stukenberg P.T., Burke D.J., Ross M.M.,Shabanowitz J., Hunt D.F., White F.M.; Nat. Biotechnol. 20:301-305(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-292 AND SER-294, ANDMASS SPECTROMETRY. | |
