| UniProt ID | YET1_YEAST | |
|---|---|---|
| UniProt AC | P35723 | |
| Protein Name | Endoplasmic reticulum transmembrane protein 1 | |
| Gene Name | YET1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 206 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi.. | |
| Protein Sequence | MSLYFTTLFLLLTVEMVMLFIFVLPLPFRIRRGIFSTYNQLTAKQQIKTIIFITGCLVGLLFIDSWKRSQIRVSLYHNDNSGSIGSSAVTPIQALASRAYNQRNMYISGFILYFSICIPTVMSIVKRLVKYQGLINEQEKQKLNKPSSNSKKDSNEADSTKLQEELRKKQISLEGLQKQVKNLEKYFDEKNQPGNVAAAEASKKGN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 87 | Phosphorylation | NSGSIGSSAVTPIQA CCCCCCCCCCCHHHH | 22.88 | 28889911 | |
| 97 | Phosphorylation | TPIQALASRAYNQRN CHHHHHHHHHHHHCC | 20.49 | 28889911 | |
| 130 | Ubiquitination | SIVKRLVKYQGLINE HHHHHHHHHHCCCCH | 36.13 | 23749301 | |
| 130 | Acetylation | SIVKRLVKYQGLINE HHHHHHHHHHCCCCH | 36.13 | 24489116 | |
| 147 | Phosphorylation | KQKLNKPSSNSKKDS HHHHCCCCCCCCCCC | 43.70 | 27214570 | |
| 148 | Phosphorylation | QKLNKPSSNSKKDSN HHHCCCCCCCCCCCC | 54.36 | 27214570 | |
| 150 | Phosphorylation | LNKPSSNSKKDSNEA HCCCCCCCCCCCCHH | 42.93 | 28889911 | |
| 161 | Acetylation | SNEADSTKLQEELRK CCHHHHHHHHHHHHH | 52.72 | 24489116 | |
| 172 | Phosphorylation | ELRKKQISLEGLQKQ HHHHHCCCHHHHHHH | 20.20 | 23749301 | |
| 178 | Acetylation | ISLEGLQKQVKNLEK CCHHHHHHHHHHHHH | 63.20 | 24489116 | |
| 185 | Acetylation | KQVKNLEKYFDEKNQ HHHHHHHHHHCCCCC | 55.15 | 24489116 | |
| 185 | Succinylation | KQVKNLEKYFDEKNQ HHHHHHHHHHCCCCC | 55.15 | 23954790 | |
| 190 | Ubiquitination | LEKYFDEKNQPGNVA HHHHHCCCCCCCCHH | 63.83 | 23749301 | |
| 190 | Acetylation | LEKYFDEKNQPGNVA HHHHHCCCCCCCCHH | 63.83 | 24489116 | |
| 202 | Phosphorylation | NVAAAEASKKGN--- CHHHHHHHHCCC--- | 26.80 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YET1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YET1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YET1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Ubiquitylation | |
| Reference | PubMed |
| "A subset of membrane-associated proteins is ubiquitinated in responseto mutations in the endoplasmic reticulum degradation machinery."; Hitchcock A.L., Auld K., Gygi S.P., Silver P.A.; Proc. Natl. Acad. Sci. U.S.A. 100:12735-12740(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-190, AND MASSSPECTROMETRY. | |