| UniProt ID | STE24_YEAST | |
|---|---|---|
| UniProt AC | P47154 | |
| Protein Name | CAAX prenyl protease 1 | |
| Gene Name | STE24 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 453 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Proteolytically removes the C-terminal three residues of farnesylated A-factor mating pheromone. Also acts to cleave the N-terminal extension of the pheromone. Does not act on Ras.. | |
| Protein Sequence | MFDLKTILDHPNIPWKLIISGFSIAQFSFESYLTYRQYQKLSETKLPPVLEDEIDDETFHKSRNYSRAKAKFSIFGDVYNLAQKLVFIKYDLFPKIWHMAVSLLNAVLPVRFHMVSTVAQSLCFLGLLSSLSTLVDLPLSYYSHFVLEEKFGFNKLTVQLWITDMIKSLTLAYAIGGPILYLFLKIFDKFPTDFLWYIMVFLFVVQILAMTIIPVFIMPMFNKFTPLEDGELKKSIESLADRVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTSKRIVLFDTLVNSNSTDEITAVLAHEIGHWQKNHIVNMVIFSQLHTFLIFSLFTSIYRNTSFYNTFGFFLEKSTGSFVDPVITKEFPIIIGFMLFNDLLTPLECAMQFVMSLISRTHEYQADAYAKKLGYKQNLCRALIDLQIKNLSTMNVDPLYSSYHYSHPTLAERLTALDYVSEKKKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 61 | Acetylation | IDDETFHKSRNYSRA CCCCHHHHCCCCHHH | 47.09 | 24489116 | |
| 238 | Phosphorylation | ELKKSIESLADRVGF HHHHHHHHHHHHHCC | 27.47 | 21440633 | |
| 249 | Acetylation | RVGFPLDKIFVIDGS HHCCCCCEEEEEECC | 45.81 | 24489116 | |
| 259 | Phosphorylation | VIDGSKRSSHSNAYF EEECCCCCCCCCCEE | 35.82 | 22890988 | |
| 260 | Phosphorylation | IDGSKRSSHSNAYFT EECCCCCCCCCCEEC | 34.66 | 22890988 | |
| 262 | Phosphorylation | GSKRSSHSNAYFTGL CCCCCCCCCCEECCC | 25.71 | 22890988 | |
| 265 | Phosphorylation | RSSHSNAYFTGLPFT CCCCCCCEECCCCCC | 13.11 | 22890988 | |
| 267 | Phosphorylation | SHSNAYFTGLPFTSK CCCCCEECCCCCCCC | 25.73 | 22890988 | |
| 272 | Phosphorylation | YFTGLPFTSKRIVLF EECCCCCCCCEEEEE | 31.25 | 22890988 | |
| 273 | Phosphorylation | FTGLPFTSKRIVLFD ECCCCCCCCEEEEEE | 21.95 | 22890988 | |
| 274 | Ubiquitination | TGLPFTSKRIVLFDT CCCCCCCCEEEEEEE | 42.98 | 17644757 | |
| 274 | Acetylation | TGLPFTSKRIVLFDT CCCCCCCCEEEEEEE | 42.98 | 24489116 | |
| 398 | Acetylation | YQADAYAKKLGYKQN HHHHHHHHHCCCCHH | 35.54 | 22865919 | |
| 419 | Phosphorylation | DLQIKNLSTMNVDPL HHHHCCCCCCCCCCC | 34.70 | 22369663 | |
| 420 | Phosphorylation | LQIKNLSTMNVDPLY HHHCCCCCCCCCCCC | 18.87 | 22369663 | |
| 427 | Phosphorylation | TMNVDPLYSSYHYSH CCCCCCCCCCCCCCC | 10.85 | 22369663 | |
| 428 | Phosphorylation | MNVDPLYSSYHYSHP CCCCCCCCCCCCCCC | 31.91 | 22369663 | |
| 429 | Phosphorylation | NVDPLYSSYHYSHPT CCCCCCCCCCCCCCC | 11.45 | 22369663 | |
| 430 | Phosphorylation | VDPLYSSYHYSHPTL CCCCCCCCCCCCCCH | 9.99 | 22369663 | |
| 432 | Phosphorylation | PLYSSYHYSHPTLAE CCCCCCCCCCCCHHH | 10.63 | 22369663 | |
| 433 | Phosphorylation | LYSSYHYSHPTLAER CCCCCCCCCCCHHHH | 15.07 | 22369663 | |
| 436 | Phosphorylation | SYHYSHPTLAERLTA CCCCCCCCHHHHHHH | 32.93 | 22369663 | |
| 450 | Acetylation | ALDYVSEKKKN---- HHHHHHHHCCC---- | 62.63 | 24489116 | |
| 450 | Ubiquitination | ALDYVSEKKKN---- HHHHHHHHCCC---- | 62.63 | 17644757 | |
| 451 | Ubiquitination | LDYVSEKKKN----- HHHHHHHCCC----- | 54.20 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STE24_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STE24_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STE24_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
