UniProt ID | LCL2_YEAST | |
---|---|---|
UniProt AC | Q08045 | |
Protein Name | Long chronological lifespan protein 2 | |
Gene Name | LCL2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 131 | |
Subcellular Localization | ||
Protein Description | Probable component of the endoplasmic reticulum-associated degradation (ERAD) pathway that acts upstream of HRD3 and USA1.. | |
Protein Sequence | MSQSRWSIVLIFALFIFGSTGVNAFFNFGHHQQQQQQQQQSYEDQVLNNPCDGYLCPDTLTCVAQQKDCPCPFPKSQLKCVLPDNKFVCISKPATHNEKFRAIYDDPVKGPKAKNKGFRDCGWVSDAYKNH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCL2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCL2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCL2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLO3_YEAST | GLO3 | genetic | 19325107 | |
HRD1_YEAST | HRD1 | genetic | 19325107 | |
HRD3_YEAST | HRD3 | genetic | 19325107 | |
MGA2_YEAST | MGA2 | genetic | 19325107 | |
RPN4_YEAST | RPN4 | genetic | 19325107 | |
USA1_YEAST | USA1 | genetic | 19325107 | |
JEM1_YEAST | JEM1 | genetic | 19325107 | |
SEC66_YEAST | SEC66 | genetic | 19325107 | |
SEC66_YEAST | SEC66 | genetic | 21987634 | |
IPK1_YEAST | IPK1 | genetic | 21987634 | |
HAC1_YEAST | HAC1 | genetic | 21987634 | |
IRE1_YEAST | IRE1 | genetic | 21987634 | |
VPS1_YEAST | VPS1 | genetic | 21987634 | |
SCJ1_YEAST | SCJ1 | physical | 22940862 | |
PP2C1_YEAST | PTC1 | genetic | 27708008 | |
MAL12_YEAST | MAL12 | genetic | 27708008 | |
RL8A_YEAST | RPL8A | genetic | 27708008 | |
SHG1_YEAST | SHG1 | genetic | 27708008 | |
SLX5_YEAST | SLX5 | genetic | 27708008 | |
RLA4_YEAST | RPP2B | genetic | 27708008 | |
ACA2_YEAST | CST6 | genetic | 27708008 | |
MOG1_YEAST | MOG1 | genetic | 27708008 | |
ELF1_YEAST | ELF1 | genetic | 27708008 | |
LGE1_YEAST | LGE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...