| UniProt ID | SPT4_YEAST | |
|---|---|---|
| UniProt AC | P32914 | |
| Protein Name | Transcription elongation factor SPT4 | |
| Gene Name | SPT4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 102 | |
| Subcellular Localization | Nucleus . Chromosome, centromere . Centromere and heterochromatin. | |
| Protein Description | The SPT4-SPT5 complex mediates both activation and inhibition of transcription elongation, and plays a role in pre-mRNA processing. The complex seems to be important for the stability of the RNA polymerase II elongation machinery on the chromatin template but not for the inherent ability of this machinery to translocate down the gene. Structural and functional component of the centromeric and heterochromatic loci linking chromatin structure with kinetochore function and gene silencing.. | |
| Protein Sequence | MSSERACMLCGIVQTTNEFNRDGCPNCQGIFEEAGVSTMECTSPSFEGLVGMCKPTKSWVAKWLSVDHSIAGMYAIKVDGRLPAEVVELLPHYKPRDGSQVE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 93 | Phosphorylation | VVELLPHYKPRDGSQ HHHHCCCCCCCCCCC | 22.28 | 24961812 | |
| 94 | Acetylation | VELLPHYKPRDGSQV HHHCCCCCCCCCCCC | 30.46 | 24489116 | |
| 99 | Phosphorylation | HYKPRDGSQVE---- CCCCCCCCCCC---- | 35.03 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPT4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPT4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPT4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
