UniProt ID | RPAB3_YEAST | |
---|---|---|
UniProt AC | P20436 | |
Protein Name | DNA-directed RNA polymerases I, II, and III subunit RPABC3 | |
Gene Name | RPB8 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 146 | |
Subcellular Localization | Nucleus . | |
Protein Description | DNA-dependent RNA polymerases catalyze the transcription. of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively.. | |
Protein Sequence | MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSNTLFDDI ------CCCCCCHHC | 38.22 | 22814378 | |
2 | Phosphorylation | ------MSNTLFDDI ------CCCCCCHHC | 38.22 | 27017623 | |
68 | Phosphorylation | SSLNLEDTPANDSSA CCCCCCCCCCCCCCC | 18.22 | 27214570 | |
73 | Phosphorylation | EDTPANDSSATRSWR CCCCCCCCCCCCCCC | 22.98 | 27214570 | |
74 | Phosphorylation | DTPANDSSATRSWRP CCCCCCCCCCCCCCC | 36.20 | 27214570 | |
136 | Ubiquitination | YRNLNNLKQENAYLL CCCCHHCCCCCEEEE | 58.66 | 23749301 | |
136 | Acetylation | YRNLNNLKQENAYLL CCCCHHCCCCCEEEE | 58.66 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPAB3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPAB3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPAB3_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-68, AND MASSSPECTROMETRY. |