| UniProt ID | RPAB5_YEAST | |
|---|---|---|
| UniProt AC | P22139 | |
| Protein Name | DNA-directed RNA polymerases I, II, and III subunit RPABC5 | |
| Gene Name | RPB10 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 70 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | DNA-dependent RNA polymerases catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RBP10 is part of the core element with the central large cleft.. | |
| Protein Sequence | MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Ubiquitination | VRCFSCGKVVGDKWE EEECCCCCCHHHHHH | 37.77 | 22817900 | |
| 17 | Ubiquitination | CGKVVGDKWESYLNL CCCCHHHHHHHHHHH | 47.10 | 23749301 | |
| 20 | Phosphorylation | VVGDKWESYLNLLQE CHHHHHHHHHHHHCC | 33.53 | 21440633 | |
| 59 | Ubiquitination | THVDLIEKFLRYNPL HHHHHHHHHHHHCCC | 42.58 | 23749301 | |
| 59 | Acetylation | THVDLIEKFLRYNPL HHHHHHHHHHHHCCC | 42.58 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPAB5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPAB5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPAB5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...