UniProt ID | SFH5_YEAST | |
---|---|---|
UniProt AC | P47008 | |
Protein Name | Phosphatidylinositol transfer protein SFH5 | |
Gene Name | SFH5 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 294 | |
Subcellular Localization |
Cytoplasm . Endoplasmic reticulum membrane Peripheral membrane protein . Microsome membrane Peripheral membrane protein . |
|
Protein Description | Non-classical phosphatidylinositol (PtdIns) transfer protein (PITP), which exhibits PtdIns-binding/transfer activity in the absence of detectable PtdCho-binding/transfer activity. Regulates PtdIns(4,5)P2 homeostasis at the plasma membrane.. | |
Protein Sequence | MKFDNDSEKQVFDKLKKAIPGIIKEKCAGYDELYGYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQNLIDILNWRREFNPLSCAYKEVHNTELQNVGILTFDANGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGLMEKGLSLLDFTSSDNNYMTQVHDYKGVSVWRMDSDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYLKDCPYEGYGGKDKKNNLTKQNVTNVHPTEYGLYILQKQIIEDVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Ubiquitination | QVFDKLKKAIPGIIK HHHHHHHHHCCHHHH | 63.08 | 23749301 | |
50 | Ubiquitination | LTQEEVDKYYDEKIA CCHHHHHHHHCHHHH | 51.38 | 23749301 | |
55 | Acetylation | VDKYYDEKIADRLTY HHHHHCHHHHHHHHH | 40.05 | 24489116 | |
143 | Acetylation | ELFQNVDKFVRYRIG HHHHCHHHHHHHHHH | 41.29 | 24489116 | |
191 | Phosphorylation | DSDIKNCSKTVIGIF CCCHHHCCHHHHHHH | 40.53 | 19779198 | |
245 | Acetylation | VVLTDGSKLGQYLKD EEECCCHHHHHHHHC | 63.27 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFH5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFH5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFH5_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PDR8_YEAST | PDR8 | physical | 18719252 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...