| UniProt ID | DYL1_YEAST | |
|---|---|---|
| UniProt AC | Q02647 | |
| Protein Name | Dynein light chain 1, cytoplasmic | |
| Gene Name | DYN2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 92 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).. | |
| Protein Sequence | MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSDENKSTP ------CCCCCCCCC | 54.34 | 22369663 | |
| 7 | Phosphorylation | -MSDENKSTPIVKAS -CCCCCCCCCCEEHH | 51.50 | 22369663 | |
| 8 | Phosphorylation | MSDENKSTPIVKASD CCCCCCCCCCEEHHH | 20.74 | 22369663 | |
| 19 | Acetylation | KASDITDKLKEDILT EHHHHCHHHHHHHEE | 53.46 | 24489116 | |
| 21 | Acetylation | SDITDKLKEDILTIS HHHCHHHHHHHEEEC | 60.11 | 24489116 | |
| 34 | Acetylation | ISKDALDKYQLERDI ECHHHHHHHHCHHHH | 35.43 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYL1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYL1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYL1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
