| UniProt ID | CAB5_YEAST | |
|---|---|---|
| UniProt AC | Q03941 | |
| Protein Name | Dephospho-CoA kinase CAB5 | |
| Gene Name | CAB5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 241 | |
| Subcellular Localization | Endoplasmic reticulum . Mitochondrion . Nucleus . Nuclear envelope. | |
| Protein Description | Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A.. | |
| Protein Sequence | MLVVGLTGGIACGKSTVSRRLRDKYKLPIVDADKIARQVVEPGQNAYDQIVLYFKDKIPNLLLEDGHLNREALGKWVFSHKEDLQALNGITHPAIRYAMFKEIGYYYLKGYRMCVLDVPLLFEGNLDSICGVTVSVICTQELQLERLMTRNPELSEEDAKNRLNSQMSTEERMARSDYILQNNSTLVDLYEQIESVVKKIQPSKLRTVLEYFPPFGAVSASSIVMSRLLMKKLQNKKSSAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Acetylation | LPIVDADKIARQVVE CCCCCHHHHHHHHCC | 39.73 | 24489116 | |
| 81 | Acetylation | GKWVFSHKEDLQALN HHHHHCCHHHHHHHC | 52.29 | 24489116 | |
| 109 | Acetylation | EIGYYYLKGYRMCVL HHCCEECCCCEEEEE | 37.46 | 24489116 | |
| 149 | Phosphorylation | LQLERLMTRNPELSE HHHHHHHHHCCCCCH | 31.70 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAB5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAB5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAB5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
