UniProt ID | LDH1_YEAST | |
---|---|---|
UniProt AC | P38139 | |
Protein Name | Lipid droplet hydrolase 1 | |
Gene Name | LDH1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 375 | |
Subcellular Localization | Lipid droplet . | |
Protein Description | Serine hydrolase required for the maintenance of steady state level of non-polar and polar lipids of lipid droplets and thus plays a role in maintaining the lipids homeostasis. Exhibits both esterase and triacylglycerol lipase activity.. | |
Protein Sequence | MNMAERAEATKSWSCEPLSGKTLEEIVQNAENAADLVAYIRKPEVDLDFRLKFIAEHEEFFNVQLSDRNSRIRTCHNLSDKGIRGDTVFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVCDVLRKWSTAVPNNDNVNPFNGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTPPKAHIEQLSKDKHIIQWALYGVFKLPWLFDVYRNKFDQVKGLQSSGIKQYFYQQGDDVKLKYRKFWQFKNNISNKSRTIIGYLLGWETVDWVKFNGVLTQTDMKQKIIIFGAEKDPIAPIENLEFYKQTINKECLRKVIILPDCSHNLCFDRPELVCENFQREVIDNSKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Ubiquitination | AERAEATKSWSCEPL HHHHHHHCCCCCCCC | 57.91 | 23749301 | |
19 | Phosphorylation | SWSCEPLSGKTLEEI CCCCCCCCCCCHHHH | 49.29 | 28889911 | |
309 | Ubiquitination | VLTQTDMKQKIIIFG EEECCCCCCEEEEEE | 51.77 | 23749301 | |
337 | Ubiquitination | FYKQTINKECLRKVI HHHHHCCHHHHCCEE | 46.05 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LDH1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LDH1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LDH1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBX2_YEAST | UBX2 | genetic | 23891562 | |
LCB2_YEAST | LCB2 | genetic | 23891562 | |
ARV1_YEAST | ARV1 | genetic | 23891562 | |
ALG6_YEAST | ALG6 | genetic | 23891562 | |
ALG8_YEAST | ALG8 | genetic | 23891562 | |
STE24_YEAST | STE24 | genetic | 23891562 | |
AAKG_YEAST | SNF4 | genetic | 23891562 | |
ERV14_YEAST | ERV14 | genetic | 23891562 | |
HMCS_YEAST | ERG13 | genetic | 23891562 | |
THIL_YEAST | ERG10 | genetic | 23891562 | |
DGK1_YEAST | DGK1 | genetic | 23891562 | |
ERG7_YEAST | ERG7 | genetic | 23891562 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...