UniProt ID | OAT_YEAST | |
---|---|---|
UniProt AC | P07991 | |
Protein Name | Ornithine aminotransferase | |
Gene Name | CAR2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 424 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MSEATLSSKQTIEWENKYSAHNYHPLPVVFHKAKGAHVWDPEGKLYLDFLSAYSAVNQGHCHPHIIKALTEQAQTLTLSSRAFHNDVYAQFAKFVTEFFGFETVLPMNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRTFGAISLSTDYEDSKLHFGPFVPNVASGHSVHKIRYGHAEDFVPILESPEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIVDEIQTGIGRTGELLCYDHYKAEAKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPGSHGSTFGGNPLASRVAIAALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMGLLTAIVIDPSKANGKTAWDLCLLMKDHGLLAKPTHDHIIRLAPPLVISEEDLQTGVETIAKCIDLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Acetylation | QTIEWENKYSAHNYH CCEEEECCCCCCCCC | 29.12 | 24489116 | |
32 | Acetylation | PLPVVFHKAKGAHVW CCCEEEEECCCCEEE | 40.09 | 22865919 | |
135 | Acetylation | KKNIPQDKAIILGAE CCCCCCCCEEEECCC | 35.92 | 24489116 | |
162 | Phosphorylation | LSTDYEDSKLHFGPF EECCCCCCCCCCCCC | 25.77 | 28889911 | |
163 | Acetylation | STDYEDSKLHFGPFV ECCCCCCCCCCCCCC | 59.30 | 24489116 | |
175 | Phosphorylation | PFVPNVASGHSVHKI CCCCCCCCCCCEEEE | 32.53 | 28889911 | |
272 | N6-(pyridoxal phosphate)lysine | PDIVLLGKALSGGVL CCEEEEEHHHCCCCE | 46.23 | - | |
272 | Other | PDIVLLGKALSGGVL CCEEEEEHHHCCCCE | 46.23 | - | |
298 | Phosphorylation | MSCFTPGSHGSTFGG HHCCCCCCCCCCCCC | 26.36 | 23749301 | |
341 | Acetylation | SSFIAQLKALQAKSN HHHHHHHHHHHHHHC | 34.66 | 24489116 | |
346 | Ubiquitination | QLKALQAKSNGIISE HHHHHHHHHCCCCEE | 31.34 | 23749301 | |
361 | Phosphorylation | VRGMGLLTAIVIDPS CCCCCEEEEEEECHH | 21.27 | 27017623 | |
368 | Phosphorylation | TAIVIDPSKANGKTA EEEEECHHHHCCCCH | 40.42 | 27017623 | |
374 | Phosphorylation | PSKANGKTAWDLCLL HHHHCCCCHHHHHHH | 34.09 | 27017623 | |
390 | Ubiquitination | KDHGLLAKPTHDHII HHCCCCCCCCCCHHH | 50.87 | 23749301 | |
390 | Acetylation | KDHGLLAKPTHDHII HHCCCCCCCCCCHHH | 50.87 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OAT_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OAT_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OAT_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNF6_YEAST | SNF6 | physical | 10688190 | |
NMA2_YEAST | NMA2 | physical | 10688190 | |
NMA1_YEAST | NMA1 | physical | 10688190 | |
GAP1_YEAST | GAP1 | genetic | 16941010 | |
PROB_YEAST | PRO1 | genetic | 16941010 | |
PUT4_YEAST | PUT4 | genetic | 16941010 | |
PROA_YEAST | PRO2 | genetic | 16941010 | |
CSG2_YEAST | CSG2 | genetic | 21623372 | |
CND2_YEAST | BRN1 | genetic | 27708008 | |
PRP9_YEAST | PRP9 | genetic | 27708008 | |
MPPA_YEAST | MAS2 | genetic | 27708008 | |
STS1_YEAST | STS1 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
PRP21_YEAST | PRP21 | genetic | 27708008 | |
GRC3_YEAST | GRC3 | genetic | 27708008 | |
POB3_YEAST | POB3 | genetic | 27708008 | |
OST2_YEAST | OST2 | genetic | 27708008 | |
MEX67_YEAST | MEX67 | genetic | 27708008 | |
TF2B_YEAST | SUA7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...